Recombinant Full Length Mycoplasma Pneumoniae Putative Abc Transporter Atp-Binding Mg390 Homolog (Mpn_571) Protein, His-Tagged
Cat.No. : | RFL3882MF |
Product Overview : | Recombinant Full Length Mycoplasma pneumoniae Putative ABC transporter ATP-binding MG390 homolog (MPN_571) Protein (P75207) (1-660aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycoplasma Pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-660) |
Form : | Lyophilized powder |
AA Sequence : | MKIIYQEQPNECGICVLGMLANELHEDKYAHDELLEQINLPASGLSFFELETYGKKFGLE IASYQLTLEELKQLEGKYFIVHFPKHFVVVHKKQDNLWEVFDPAKGKYLLNDEELKKQWT GYAATVQKSFKEIPPINKRNFFKHFFDLNLIIFYVFIELIIIGISTLLATASKTMIANTV DFGTSVNIVVFVVFFLVLKGLYLLLYALLQMVRNVLFWKQYRGYLGWIMQTLQTKSFVYF SNKSPNQLTERQFYLKEVLSFFNVHIPNLIISCTVALIIGTLIGINQMEFLWIAIVQIVV NCAIFLYDFFFTKRITKQAIPQMELQNKVSLQLDGNLRDEQNGKRFNYLMMQLRKALIKN QNISNQKEVNHLASDGVKSFAQQVFDFLILALGIIGIIEQRYTLAFLFYIFSIQALFSAY ATRIIQFGAAVNLYQFCKDKLVTLFEDKVNDCNFKVSWKCPKVINLNNCSITLNQNLDLA NLNLNLTNGMVISGENGSGKSTLLKILTGRGLSYQGQIKLDELDLKDFSASQLFHNVYYL TGQLTAYNDITDFGYSEALLNCKNPQVYQLLADTGIHNQIKLSSGQKQILQLFLLQNLKD KVILLDETLNAIATELKPRVYQLLIKPLTYNNFVLMVEHDLRFVNSEQDLINLSPYLQQT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MPN_571 |
Synonyms | MPN_571; D02_orf660; MP271; Putative ABC transporter ATP-binding MG390 homolog |
UniProt ID | P75207 |
◆ Recombinant Proteins | ||
FAM24A-2243R | Recombinant Rat FAM24A Protein | +Inquiry |
BPIFA2-5806H | Recombinant Human BPIFA2 protein | +Inquiry |
S-491S | Active Recombinant SARS-CoV-2 (2019-nCoV) Spike S1(D614G) Protein, His-tagged, HPLC-verified | +Inquiry |
FGFR2-705HAF555 | Recombinant Human FGFR2 Protein, Fc/His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
DCLK3-2233M | Recombinant Mouse DCLK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Heparin-200S | Active Native Swine Heparin | +Inquiry |
A1m-367M | Native Mouse A1m | +Inquiry |
Prothrombin-92M | Native Mouse Prothrombin | +Inquiry |
LDH-228H | Native Human Lactate Dehydrogenase Total | +Inquiry |
HP-146R | Native Rabbit Hemoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMUG1-1648HCL | Recombinant Human SMUG1 293 Cell Lysate | +Inquiry |
CSH2-7247HCL | Recombinant Human CSH2 293 Cell Lysate | +Inquiry |
GMPPB-5878HCL | Recombinant Human GMPPB 293 Cell Lysate | +Inquiry |
MAP6-401HCL | Recombinant Human MAP6 lysate | +Inquiry |
PANK1-1278HCL | Recombinant Human PANK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MPN_571 Products
Required fields are marked with *
My Review for All MPN_571 Products
Required fields are marked with *
0
Inquiry Basket