Recombinant Full Length Mycoplasma Penetrans Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged
Cat.No. : | RFL30475MF |
Product Overview : | Recombinant Full Length Mycoplasma penetrans Prolipoprotein diacylglyceryl transferase(lgt) Protein (Q8EWA4) (1-356aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycoplasma penetrans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-356) |
Form : | Lyophilized powder |
AA Sequence : | MTMNNFTTTMQDISTAFTIGSLEIKWYGIFITVGFVLAIILACVKLEKWYKISCNPFYWF VFIGIPVSLLGARIWSFIIGDASKSLATQNFFAAFFNFREGGLAIEGGVLLTVIAALIYF PLVLKKPQYNVKTKIGNEYYVKQVSMWVYADAIVPCILVGQIIGRWGNFFNQEVYGPIAT EAELAWLKTLMPGVYNNMFITTTGNLHHPFFLYESFINFWFFLAIYIGGEFIKKRKAGDL AIAYFICYGLLRSCMEPFRYSDYQFATSIVMSVLFALFGIILLVCNHLVFSKHRDFKFWE FIIYKTKKFFKQDIKEFLDSKRNADNLKVQKQINKNITKEPNFYRKPSEIFYYNGY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lgt |
Synonyms | lgt; MYPE3000; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase |
UniProt ID | Q8EWA4 |
◆ Recombinant Proteins | ||
ANKRD27-1662M | Recombinant Mouse ANKRD27 Protein | +Inquiry |
MOB4-5620M | Recombinant Mouse MOB4 Protein, His (Fc)-Avi-tagged | +Inquiry |
INHBA-5266H | Recombinant Human Inhibin, Beta A, His-tagged | +Inquiry |
RFL16807CF | Recombinant Full Length Candida Albicans Altered Inheritance Of Mitochondria Protein 36, Mitochondrial(Aim36) Protein, His-Tagged | +Inquiry |
RFL-21119RF | Recombinant Full Length Rat Aquaporin-4(Aqp4) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
APOC2-27331TH | Native Human APOC2 protein | +Inquiry |
MPO-8220H | Native Human Neutrophil Myeloperoxidase | +Inquiry |
LYZ-5316H | Native Human Lysozyme(salivary) | +Inquiry |
MMP9-39H | Native Human MMP-9/Lipocalin Complex | +Inquiry |
CDA016 | Native Hepatitis B Surface Ag protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRPM3-739HCL | Recombinant Human TRPM3 293 Cell Lysate | +Inquiry |
PLDN-3120HCL | Recombinant Human PLDN 293 Cell Lysate | +Inquiry |
PAX9-3411HCL | Recombinant Human PAX9 293 Cell Lysate | +Inquiry |
MYL12B-4029HCL | Recombinant Human MYL12B 293 Cell Lysate | +Inquiry |
AFM-794HCL | Recombinant Human AFM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lgt Products
Required fields are marked with *
My Review for All lgt Products
Required fields are marked with *
0
Inquiry Basket