Recombinant Full Length Mycobacterium Ulcerans Upf0353 Protein Mul_1490 (Mul_1490) Protein, His-Tagged
Cat.No. : | RFL15655MF |
Product Overview : | Recombinant Full Length Mycobacterium ulcerans UPF0353 protein MUL_1490 (MUL_1490) Protein (A0PNU3) (1-335aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium ulcerans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-335) |
Form : | Lyophilized powder |
AA Sequence : | MTLPLLGPMTLSGFAHSWFFLFLLVVAGLIAIYVVLQLARQKRMLRFANMELLESVAPQR PSRYRHIPAMLLALSLVLFTVAMAGPTHDVRIPRNRAVVMLVIDVSQSMRATDVEPNRMV AAQEAAKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKAALDKLQFADRTATGEAI FTALQAIATVGAVIGGGDTPPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKDQGVPIS TISFGTPYGFVEINDQRQPVPVDDETMKKVAQLSGGNSYNAATLAELNSVYVSLQQQIGY ETIRGDASMGWLRLGALVLVAAALAALLINRRLPT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MUL_1490 |
Synonyms | MUL_1490; UPF0353 protein MUL_1490 |
UniProt ID | A0PNU3 |
◆ Recombinant Proteins | ||
DLG1-9483HCL | Recombinant Human DLG1 cell lysate | +Inquiry |
SCAMP5-4086R | Recombinant Rhesus monkey SCAMP5 Protein, His-tagged | +Inquiry |
RIPK1-CDC37-165HFL | Active Recombinant Full Length Human RIPK1 and CDC37 Co-expressed Protein, C-His-tagged | +Inquiry |
S-121S | Recombinant SARS-CoV-2 Spike RBD (F342L) Mutant Protein, His-tagged | +Inquiry |
EPB41L1-3353H | Recombinant Human EPB41L1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
IBVQ0291-229I | Native Influenza (B/Qingdao/102/91) IBVQ0291 protein | +Inquiry |
LYZ-5316H | Native Human Lysozyme(salivary) | +Inquiry |
SOD1-102B | Active Native Bovine SOD, modified | +Inquiry |
PLAT-30946TH | Native Human PLAT | +Inquiry |
IgM-331S | Native Sheep IgM | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNIP1-1628HCL | Recombinant Human SNIP1 293 Cell Lysate | +Inquiry |
BIN2-8453HCL | Recombinant Human BIN2 293 Cell Lysate | +Inquiry |
ACOT1-9091HCL | Recombinant Human ACOT1 293 Cell Lysate | +Inquiry |
ART3-1148HCL | Recombinant Human ART3 cell lysate | +Inquiry |
CEACAM3-2074HCL | Recombinant Human CEACAM3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MUL_1490 Products
Required fields are marked with *
My Review for All MUL_1490 Products
Required fields are marked with *
0
Inquiry Basket