Recombinant Full Length Mycobacterium Paratuberculosis Upf0353 Protein Map_3434(Map_3434) Protein, His-Tagged
Cat.No. : | RFL14981MF |
Product Overview : | Recombinant Full Length Mycobacterium paratuberculosis UPF0353 protein MAP_3434(MAP_3434) Protein (Q73UD4) (1-330aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium paratuberculosis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-330) |
Form : | Lyophilized powder |
AA Sequence : | MGVVSLPGIGPLPLYGFQRPGMLLFGLVPLALLALYLVVQARRRRRLHRYTDAPVAQSPW RHLPIAVSLLSLVLLTIALATPTHDMRIPRNRAVIMLVIDMSQSMRATDVEPNRLKAAEQ AASQFASQLTPGINLGLVGFAGTPYLLVPPTPQHQATIDALKKLDFADSTATGEAIFTAL HAISATAVAGGDTPPPARIVLLSDGGENKPSNPSDPHDGVYTAARLAKDEGVPISTITFG TKGGEIEMDGQKVAVPVSTDQMKMVAKLSGGQSYTATNLGELQKSYNAIENEIGYRTVPG PGSAGWLRLGVLTALIATALALLINRRLPT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MAP_3434 |
Synonyms | MAP_3434; UPF0353 protein MAP_3434 |
UniProt ID | Q73UD4 |
◆ Recombinant Proteins | ||
ZDHHC8-01H | Recombinant Human ZDHHC8 Protein (1-42), N-GST tagged | +Inquiry |
RFL20495HF | Recombinant Full Length Hahella Chejuensis Protease Htpx(Htpx) Protein, His-Tagged | +Inquiry |
TMEM144B-1508Z | Recombinant Zebrafish TMEM144B | +Inquiry |
LGALS9-432H | Recombinant Human LGALS9 Protein, His/GST-tagged | +Inquiry |
RFL15909AF | Recombinant Full Length Agrobacterium Vitis Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
IgA-239S | Native Sheep Immunoglobulin A | +Inquiry |
VTN-5410H | Native Human Vitronectin | +Inquiry |
AMY1A-8022H | Native Human Salivary Amylase | +Inquiry |
SERPINC1-8032H | Native Human Plasma AntiThromblin III | +Inquiry |
CRP-4303H | Native Human C-reactive Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FANCG-6331HCL | Recombinant Human FANCG 293 Cell Lysate | +Inquiry |
MMP26-4274HCL | Recombinant Human MMP26 293 Cell Lysate | +Inquiry |
MRPS27-4139HCL | Recombinant Human MRPS27 293 Cell Lysate | +Inquiry |
LSAMP-1755HCL | Recombinant Human LSAMP cell lysate | +Inquiry |
Tongue-532D | Dog Tongue Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAP_3434 Products
Required fields are marked with *
My Review for All MAP_3434 Products
Required fields are marked with *
0
Inquiry Basket