Recombinant Full Length Mycobacterium Bovis Large-Conductance Mechanosensitive Channel(Mscl) Protein, His-Tagged
Cat.No. : | RFL36690MF |
Product Overview : | Recombinant Full Length Mycobacterium bovis Large-conductance mechanosensitive channel(mscL) Protein (C1ALX4) (1-151aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-151) |
Form : | Lyophilized powder |
AA Sequence : | MLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNAQSDVGILRIG IGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGEVEQPGDTQVVLLTEIRDL LAQTNGDSPGRHGGRGTPSPTDGPLASTESQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mscL |
Synonyms | mscL; JTY_1012; Large-conductance mechanosensitive channel |
UniProt ID | C1ALX4 |
◆ Recombinant Proteins | ||
RFL5816MF | Recombinant Full Length Mouse Calcium Uniporter Protein, Mitochondrial(Mcu) Protein, His-Tagged | +Inquiry |
TNFRSF18-2769H | Recombinant Human TNFRSF18 Protein, His-tagged | +Inquiry |
CLEC2G-1441R | Recombinant Rat CLEC2G Protein | +Inquiry |
PSMG1-1917C | Recombinant Chicken PSMG1 | +Inquiry |
RFL5220RF | Recombinant Full Length Rhodobacter Capsulatus Atp Synthase Subunit B(Atpf) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
PLE-105P | Active Native Porcine Esterase | +Inquiry |
CP-8074M | Native Mouse Serum Ceruloplasmin | +Inquiry |
IgG-169H | Native Human IgG Fc fragment | +Inquiry |
F13A1-5399H | Native Human Coagulation Factor XIII, A1 Polypeptide | +Inquiry |
ACP-150P | Active Native Potato Acid Phosphatase | +Inquiry |
◆ Cell & Tissue Lysates | ||
HEBP2-5592HCL | Recombinant Human HEBP2 293 Cell Lysate | +Inquiry |
UNC45B-1886HCL | Recombinant Human UNC45B cell lysate | +Inquiry |
TMX1-900HCL | Recombinant Human TMX1 293 Cell Lysate | +Inquiry |
CLDN4-7462HCL | Recombinant Human CLDN4 293 Cell Lysate | +Inquiry |
Spleen-469B | Bovine Spleen Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mscL Products
Required fields are marked with *
My Review for All mscL Products
Required fields are marked with *
0
Inquiry Basket