Recombinant Full Length Mycobacterium Avium Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged
Cat.No. : | RFL4134MF |
Product Overview : | Recombinant Full Length Mycobacterium avium Prolipoprotein diacylglyceryl transferase(lgt) Protein (A0QHG7) (1-440aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium avium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-440) |
Form : | Lyophilized powder |
AA Sequence : | MTKLLAYFPSPPQGVWHLGPVPIRAYALFIIAGIVAALLIGDRRWEARGGERGVIYDIAL WTVPFGLVGGRLYHLATDWRTYWGPGGAGFGAAVRIWDGGLGIWGAVALGAVGAWIGCRR HGIPLPAFADALAPGIILAQAIGRLGNYFNQELYGRETTLPWGLEIFYRRDPSGYIDPHS LDGVSTGQVALVVQPTFLYELLWNLLIFVALLYADRRLTLGHGRLFALYVAGYCVGRFCV ELLRDDTATHIAGIRINSFTSTFVFIGAVVYLMAAPKGREDPESLRGNQYVEEEPAEPEP ATVAATTEAATEGVAAPADGAEAAGADATAQRPEESAEPDVEKPESEETEAEAAEEPESE ETEAAEEPGEPEAEEPEEPEAEEPEEPETEEPEADSDEEPEEESGEAPEQPVAEEPEPAP QQPETKRRWGARLRDRLSGR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lgt |
Synonyms | lgt; MAV_3172; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase |
UniProt ID | A0QHG7 |
◆ Recombinant Proteins | ||
PRODH-326H | Recombinant Full Length Human PRODH Protein, His-tagged | +Inquiry |
ATP6V0E2-889R | Recombinant Rat ATP6V0E2 Protein | +Inquiry |
FBXL16-4949HF | Recombinant Full Length Human FBXL16 Protein, GST-tagged | +Inquiry |
RFL17645LF | Recombinant Full Length Leontopithecus Chrysomelas Melanocyte-Stimulating Hormone Receptor(Mc1R) Protein, His-Tagged | +Inquiry |
SAOUHSC-00230-1323S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_00230 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Gamma Globulin-72H | Native Human Gamma Globulin | +Inquiry |
PRTN3-243H | Native Human PRTN3 Protein | +Inquiry |
Troponin I-11H | Native Human Troponin I protein | +Inquiry |
PGC-132H | Native Human Pepsinogen II | +Inquiry |
Lectin-1811M | Active Native Maclura Pomifera Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PANK3-3444HCL | Recombinant Human PANK3 293 Cell Lysate | +Inquiry |
CD1D-2479HCL | Recombinant Human CD1D cell lysate | +Inquiry |
TBC1D2-1739HCL | Recombinant Human TBC1D2 cell lysate | +Inquiry |
HBXIP-5616HCL | Recombinant Human HBXIP 293 Cell Lysate | +Inquiry |
JAM3-1074HCL | Recombinant Human JAM3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lgt Products
Required fields are marked with *
My Review for All lgt Products
Required fields are marked with *
0
Inquiry Basket