Recombinant Full Length Mouse Vesicle Transport Protein Sft2B(Sft2D2) Protein, His-Tagged
Cat.No. : | RFL29516MF |
Product Overview : | Recombinant Full Length Mouse Vesicle transport protein SFT2B(Sft2d2) Protein (Q8VD57) (1-159aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-159) |
Form : | Lyophilized powder |
AA Sequence : | MDKLKKVLSGQDTEDRSGLSEVVEASSLSWGTRIKGFIACFALGILCSVLGTLLLWVPRK GLGLFAVFYTLGNIMSIGSTVFLMGPLKQLKRMFEPTRLIATILVLLCFALTLCSAFLWN KGLALIFCILQSLALTWYSLSYIPYARDAVKKCFAVCLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Sft2d2 |
Synonyms | Sft2d2; Vesicle transport protein SFT2B; SFT2 domain-containing protein 2 |
UniProt ID | Q8VD57 |
◆ Recombinant Proteins | ||
SFT2D2-15016M | Recombinant Mouse SFT2D2 Protein | +Inquiry |
RFL22482HF | Recombinant Full Length Human Vesicle Transport Protein Sft2B(Sft2D2) Protein, His-Tagged | +Inquiry |
SFT2D2-3992R | Recombinant Rhesus Macaque SFT2D2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SFT2D2-4175R | Recombinant Rhesus monkey SFT2D2 Protein, His-tagged | +Inquiry |
SFT2D2-5015R | Recombinant Rat SFT2D2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SFT2D2-590HCL | Recombinant Human SFT2D2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Sft2d2 Products
Required fields are marked with *
My Review for All Sft2d2 Products
Required fields are marked with *
0
Inquiry Basket