Recombinant Full Length Mouse Tumor Necrosis Factor Receptor Superfamily Member 6(Fas) Protein, His-Tagged
Cat.No. : | RFL9899MF |
Product Overview : | Recombinant Full Length Mouse Tumor necrosis factor receptor superfamily member 6(Fas) Protein (P25446) (22-327aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-327) |
Form : | Lyophilized powder |
AA Sequence : | QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRLWLLTILVLLIPLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLSKYIPRIAEDMTIQEAKKFARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSDAYQDLIKGLKKAECRRTLDKFQDMVQKDLGKSTPDTGNENEGQCLE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Fas |
Synonyms | Fas; Apt1; Tnfrsf6; Tumor necrosis factor receptor superfamily member 6; Apo-1 antigen; Apoptosis-mediating surface antigen FAS; FASLG receptor; CD antigen CD95 |
UniProt ID | P25446 |
◆ Recombinant Proteins | ||
FAS-3853H | Recombinant Human FAS Protein, GST-tagged | +Inquiry |
FAS-2F | Recombinant Feline FAS Protein, His (Fc)-Avi-tagged | +Inquiry |
FAS-4338C | Recombinant Chicken FAS | +Inquiry |
FAS-16H | Recombinant Human FAS protein, MYC/DDK-tagged | +Inquiry |
FAS-1468R | Recombinant Rhesus Macaque FAS Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAS-001CCL | Recombinant Cynomolgus FAS cell lysate | +Inquiry |
FAS-1139RCL | Recombinant Rat FAS cell lysate | +Inquiry |
FAS-2419MCL | Recombinant Mouse FAS cell lysate | +Inquiry |
FAS-2185HCL | Recombinant Human FAS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fas Products
Required fields are marked with *
My Review for All Fas Products
Required fields are marked with *
0
Inquiry Basket