Recombinant Full Length Mouse TNFRSF9 Protein, Fc-tagged

• Cat.No.: TNFRSF9-583M
• Product Overview: Recombinant Mouse TNFRSF9 protein with Fc tag was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: Fc
• Protein Length: 1-256 a.a.
• Description: Enables cytokine binding activity; identical protein binding activity; and signaling receptor activity. Acts upstream of or within negative regulation of interleukin-10 production; negative regulation of interleukin-12 production; and regulation of cell population proliferation. Located in external side of plasma membrane and extracellular space. Is expressed in renal vasculature. Orthologous to human TNFRSF9 (TNF receptor superfamily member 9).
• Form: Lyophilized
• Molecular Mass: 46.7 kDa
• AA Sequence: MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPAFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: Tnfrsf9 tumor necrosis factor receptor superfamily, member 9 [ Mus musculus (house mouse) ]
• Official Symbol: TNFRSF9
• Synonyms: TNFRSF9; tumor necrosis factor receptor superfamily, member 9; tumor necrosis factor receptor superfamily member 9; CD137 antigen; T-cell antigen 4-1BB; 4-1BB ligand receptor; secreted CD137 antigen; ILA; Ly63; 4-1BB; Cd137; CDw137; AA408498; AI325004; A930040I11Rik
• Gene ID: 21942
• mRNA Refseq: NM_001077508
• Protein Refseq: NP_001070976
• UniProt ID: P20334