Recombinant Full Length Mouse T-Cell Surface Antigen Cd2(Cd2) Protein, His-Tagged
Cat.No. : | RFL914MF |
Product Overview : | Recombinant Full Length Mouse T-cell surface antigen CD2(Cd2) Protein (P08920) (23-344aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (23-344) |
Form : | Lyophilized powder |
AA Sequence : | RDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPMIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLNAPFKCEAINPVSKESKMEVVNCPEKGLSFYVTVGVGAGGLLLVLLVALFIFCICKRRKRNRRRKDEELEIKASRTSTVERGPKPHSTPAAAAQNSVALQAPPPPGHHLQTPGHRPLPPGHRTREHQQKKRPPPSGTQIHQQKGPPLPRPRVQPKPPCGSGDGVSLPPPN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cd2 |
Synonyms | Cd2; Ly-37; T-cell surface antigen CD2; LFA-2; LFA-3 receptor; Lymphocyte antigen 37; T-cell surface antigen T11/Leu-5; CD antigen CD2 |
UniProt ID | P08920 |
◆ Recombinant Proteins | ||
CD2-2392H | Recombinant Human CD2 Molecule | +Inquiry |
CD2-2951H | Active Recombinant Human CD2 protein, His-Avi-tagged, Biotinylated | +Inquiry |
CD2-657H | Recombinant Human CD2 Protein, His-tagged | +Inquiry |
CD2-168H | Recombinant Human CD2 Protein, His-tagged | +Inquiry |
CD2-163C | Recombinant Canine CD2, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD2-1372RCL | Recombinant Rat CD2 cell lysate | +Inquiry |
CD2-001CCL | Recombinant Cynomolgus CD2 cell lysate | +Inquiry |
CD2-2553HCL | Recombinant Human CD2 cell lysate | +Inquiry |
CD2-002CCL | Recombinant Canine CD2 cell lysate | +Inquiry |
CD2-2221MCL | Recombinant Mouse CD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cd2 Products
Required fields are marked with *
My Review for All Cd2 Products
Required fields are marked with *
0
Inquiry Basket