Recombinant Full Length Mouse Syndecan-4(Sdc4) Protein, His-Tagged
Cat.No. : | RFL15657MF |
Product Overview : | Recombinant Full Length Mouse Syndecan-4(Sdc4) Protein (O35988) (24-198aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (24-198) |
Form : | Lyophilized powder |
AA Sequence : | ESIRETEVIDPQDLLEGRYFSGALPDDEDAGGSDDFELSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRAPSDVGDDMSNKVSMSSTAQGSNIFERTEVLAALIVGGVVGILFAVFLILLLVYRMKKKDEGSYDLGKKPIYKKAPTNEFYA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Sdc4 |
Synonyms | Sdc4; Syndecan-4; SYND4; Ryudocan core protein |
UniProt ID | O35988 |
◆ Recombinant Proteins | ||
SDC4-19H | Active Recombinant Human SDC4, His-tagged | +Inquiry |
SDC4-411H | Recombinant Human SDC4 Protein (Met1-Glu145), His-tagged | +Inquiry |
SDC4-1992C | Recombinant Chicken SDC4 protein, His & T7-tagged | +Inquiry |
Sdc4-963M | Active Recombinant Mouse Sdc4 Protein, His-tagged | +Inquiry |
SDC4-4449Z | Recombinant Zebrafish SDC4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SDC4-1057MCL | Recombinant Mouse SDC4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Sdc4 Products
Required fields are marked with *
My Review for All Sdc4 Products
Required fields are marked with *
0
Inquiry Basket