Recombinant Full Length Mouse Sphingosine 1-Phosphate Receptor 2(S1Pr2) Protein, His-Tagged

• Cat.No.: RFL29619MF
• Product Overview: Recombinant Full Length Mouse Sphingosine 1-phosphate receptor 2(S1pr2) Protein (P52592) (1-352aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E.coli expression system
• Species: Mus musculus (Mouse)
• Tag: His
• Form: Lyophilized powder
• Protein length: Full Length (1-352)
• AA Sequence: MGGLYSEYLNPEKVLEHYNYTKETLDMQETTSRKVASAFIIILCCAIVVENLLVLIAVAR NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGHVTLSLTPVQWFAREGSAFITLSASV FSLLAIAIERQVALAKVKLYGSDKSCRMLMLIGASWLISLILGGLPILGWNCLNQLEACS TVLPLYAKHYVLCVVTIFSVILLAIVALYVRIYFVVRSSHADVAGPQTLALLKTVTIVLG VFIICWLPAFSILLLDSTCPVRACPVLYKAHYFFAFATLNSLLNPVIYTWRSRDLRREVL RPLQCWRRGKGVTGRRGGNPGHRLLPLRSSSSLERGMHMPTSPTFLEGNTVV
• Purity: Greater than 90% as determined by SDS-PAGE.
• Applications: SDS-PAGE
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: S1pr2
• Synonyms: S1pr2; Edg5; Gpcr13; Lpb2; Sphingosine 1-phosphate receptor 2; S1P receptor 2; S1P2; Endothelial differentiation G-protein coupled receptor 5; Lysophospholipid receptor B2; Sphingosine 1-phosphate receptor Edg-5; S1P receptor Edg-5
• UniProt ID: P52592