Recombinant Full Length Mouse Solute Carrier Family 25 Member 46(Slc25A46) Protein, His-Tagged
Cat.No. : | RFL11407MF |
Product Overview : | Recombinant Full Length Mouse Solute carrier family 25 member 46(Slc25a46) Protein (Q9CQS4) (1-418aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-418) |
Form : | Lyophilized powder |
AA Sequence : | MHPRRPEGFDGLGYRGGVRDDPAFGGPFHARSFGSGTELGHWVTTPPDIPGSRNLHWGEK SPSYGVPSAPPTLEGSAEEPFPGGGEGPRPGPSSEQLNRFAGFGIGLASLFTENVLAHPC IVLRRQCQVNYHARHYHLTPFSIINIMYSFNKTQGPRALWKGMGSTFIVQGVTLGAEGII SEFTPLPREVSHKLNPKQIGEHLLLKCLTYMVAMPFYSASLIETVQSEIIRDNTGILECV KEGIGRVIGLGVPHSKRLLPLFSLIFPTVLHGVLHYIISSIIQKIVLLILKRKTYNSHLA ESTSPMQNMLDAYFPELIANFAASLCSDVILYPLETVLHRLHIQGTRTIIDNTDLGYEVL PINTQYEGMRDCINTIKQEEGVFGFYKGFGAVIIQYTLHATILQITKMIYSTLLQNSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Slc25a46 |
Synonyms | Slc25a46; Solute carrier family 25 member 46 |
UniProt ID | Q9CQS4 |
◆ Recombinant Proteins | ||
RFL31255DF | Recombinant Full Length Danio Rerio Solute Carrier Family 25 Member 46(Slc25A46) Protein, His-Tagged | +Inquiry |
RFL10759RF | Recombinant Full Length Rat Solute Carrier Family 25 Member 46(Slc25A46) Protein, His-Tagged | +Inquiry |
SLC25A46-3497H | Recombinant Human SLC25A46 protein, His-tagged | +Inquiry |
SLC25A46-1756C | Recombinant Chicken SLC25A46 | +Inquiry |
SLC25A46-2681H | Recombinant Human SLC25A46 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A46-1758HCL | Recombinant Human SLC25A46 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Slc25a46 Products
Required fields are marked with *
My Review for All Slc25a46 Products
Required fields are marked with *
0
Inquiry Basket