Recombinant Full Length Mouse Ring Finger Protein 112(Rnf112) Protein, His-Tagged
Cat.No. : | RFL25055MF |
Product Overview : | Recombinant Full Length Mouse RING finger protein 112(Rnf112) Protein (Q96DY5) (1-654aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-654) |
Form : | Lyophilized powder |
AA Sequence : | MPRPVLSVTAFCHRLGKRESKRSFMGNSSNSWVLPREEAQGWMGQAVQGGTRTSRSHASF PKLELGLGHRPSPTREPPTCSICLERLREPISLDCGHDFCIRCFSTHRIPGCELPCCPEC RKICKQRKGLRSLGERMKLLPQRPLPPALQETCAVRAERLLLVRINASGGLILRMGAINR CLKHPLARDTPVCLLAVLGEQHSGKSFLLDHLLSGLPSLESGDSGRPRAEGSLPGIRWGA NGLTRGIWMWSHPFLLGKEGKKVAVFLVDTGDVMSPELSKETRVKLCALTMMLSSYQILN TSQELKDTDLGYLEMFVHVAEVMGKHYGMVPIQHLDLLVRDSSHHNKSGQGHVGDILQKL SGKYPKVQELLLGKRARCYLLPAPERQWVNKDQASPRGNTEDDFSHHFRAYILDVLSTAP QHAKSRCQGYWSEGRAVARGDRRLLTGQQLAQEIKNLSGWMGKTGPSFNSPDEMAAQLHD LRKVEAAKKEFEEYVRQQDIATKRIFSALRVLPDTMRNLLSTQKDAILARHGVALLCKER EQTLEALEAELQAEAKAFMDSYTMRFCGHLAAVGGAVGAGLMGLAGGVVGAGMAAAALAA EAGMVAAGAAVGATGAAVVGGGVGAGLAATVGCMEKEEDERVQGGDREPLLQEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rnf112 |
Synonyms | Rnf112; Bfp; Znf179; RING finger protein 112; Brain finger protein; Neurolastin; Zinc finger protein 179 |
UniProt ID | Q96DY5 |
◆ Native Proteins | ||
Lysostaphin-91S | Active Native Staphylococcus staphylolyticus Lysostaphin | +Inquiry |
IgG-169H | Native Human IgG Fc fragment | +Inquiry |
IgG-253R | Native Rabbit IgG Protein, Tag Free, Agarose Conjugated | +Inquiry |
Tenascin-112H | Native Human Tenascin | +Inquiry |
GG-189S | Native Sheep Gamma Globulin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXB1-810HCL | Recombinant Human HOXB1 cell lysate | +Inquiry |
PLXNA4-3091HCL | Recombinant Human PLXNA4 293 Cell Lysate | +Inquiry |
SOCS2-1581HCL | Recombinant Human SOCS2 293 Cell Lysate | +Inquiry |
EVI5-6517HCL | Recombinant Human EVI5 293 Cell Lysate | +Inquiry |
BCAT2-162HCL | Recombinant Human BCAT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Rnf112 Products
Required fields are marked with *
My Review for All Rnf112 Products
Required fields are marked with *
0
Inquiry Basket