Recombinant Full Length Mouse Proto-Oncogene Mas(Mas1) Protein, His-Tagged
Cat.No. : | RFL33577MF |
Product Overview : | Recombinant Full Length Mouse Proto-oncogene Mas(Mas1) Protein (P30554) (1-324aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-324) |
Form : | Lyophilized powder |
AA Sequence : | MDQSNMTSLAEEKAMNTSSRNASLGSSHPPIPIVHWVIMSISPLGFVENGILLWFLCFRM RRNPFTVYITHLSIADISLLFCIFILSIDYALDYELSSGHHYTIVTLSVTFLFGYNTGLY LLTAISVERCLSVLYPIWYRCHRPKHQSAFVCALLWALSCLVTTMEYVMCIDSGEESHSR SDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIIIFLIFA MPMRVLYLLYYEYWSAFGNLHNISLLFSTINSSANPFIYFFVGSSKKKRFRESLKVVLTR AFKDEMQPRRQEGNGNTVSIETVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Mas1 |
Synonyms | Mas1; Mas; Mas-1; Proto-oncogene Mas |
UniProt ID | P30554 |
◆ Recombinant Proteins | ||
C9orf24-6561H | Recombinant Human C9orf24 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CSRNP2-2016H | Recombinant Human CSRNP2 Protein, GST-tagged | +Inquiry |
RFL1895AF | Recombinant Full Length Alkalilimnicola Ehrlichei Electron Transport Complex Protein Rnfa(Rnfa) Protein, His-Tagged | +Inquiry |
SLC17A8-4066H | Recombinant Human SLC17A8 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCL13-131H | Recombinant Human CXCL13 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
BCHE-5291H | Native Human Butyrylcholinesterase | +Inquiry |
TF-31156TH | Native Human TF | +Inquiry |
Gamma Globulin-72H | Native Human Gamma Globulin | +Inquiry |
COL4A1-001H | Native Human COL4A1 Protein | +Inquiry |
LTF-229B | Native Bovine Lactoferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD22-001MCL | Recombinant Mouse CD22 cell lysate | +Inquiry |
FSTL4-674HCL | Recombinant Human FSTL4 cell lysate | +Inquiry |
DEFA6-6990HCL | Recombinant Human DEFA6 293 Cell Lysate | +Inquiry |
TPRG1-837HCL | Recombinant Human TPRG1 293 Cell Lysate | +Inquiry |
TIMM13-1072HCL | Recombinant Human TIMM13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Mas1 Products
Required fields are marked with *
My Review for All Mas1 Products
Required fields are marked with *
0
Inquiry Basket