Recombinant Full Length Mouse Protein Fam73B(Fam73B) Protein, His-Tagged
Cat.No. : | RFL2193MF |
Product Overview : | Recombinant Full Length Mouse Protein FAM73B(Fam73b) Protein (Q8BK03) (1-593aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-593) |
Form : | Lyophilized powder |
AA Sequence : | MAFRRTEGMSMIQALAMTVAEIPVFLYTTFGQSAFSQLRLTPGLRKVLFATALGTVALAL AAHQLKRRRRKKKQVGPEMGGEQLGTVPMPILMARKVPSVKKGCSSRRVQSPSSKSNDTL SGISSIEPSKHSGSSHSLASMVVVNSSSPTAACSGSWEARGMEESVPTTDGSAESLYVQG MELFEEALQKWEQALSVGQRGDGGSTPTPGDSLQNPDTASEALSEPESQRREFAEKLESL LHRAYHLQEEFGSTFPSDSMLLDLERTLMLPLTEGSLRLRADDEDSLTSEDSFFSATEIF ESLQIGEYPLPLSRPAAAYEEALQLVKEGRVPCRTLRTELLGCYSDQDFLAKLHCVRQAF EGLLEERSNQIFFGEVGRQMVTGLMTKAEKSPKGFLESYEEMLSYALRPETWATTRLELE GRGVACMSFFDIVLDFILMDAFEDLENPPSSVLAVLRNRWLSDSFKETALATACWSVLKA KRRLLMVPDGFISHFYSVSEHVSPVLAFGFLGPKPQLSEVCAFFKHQIVQYLRDMFDLDN VRYTSVPALAEDILQLSRRRSEILLGYLGAPVASSIGLNGPLPRENGPLEELQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Miga2 |
Synonyms | Miga2; Fam73b; Mitoguardin 2; Protein FAM73B |
UniProt ID | Q8BK03 |
◆ Recombinant Proteins | ||
CDCP2-3161M | Recombinant Mouse CDCP2 Protein | +Inquiry |
RFL28101LF | Recombinant Full Length Listeria Welshimeri Serovar 6B Upf0754 Membrane Protein Lwe2241 (Lwe2241) Protein, His-Tagged | +Inquiry |
PDCD10A-10836Z | Recombinant Zebrafish PDCD10A | +Inquiry |
PCNXL2-6558M | Recombinant Mouse PCNXL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LRRC3C-1642H | Recombinant Human LRRC3C protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
Thyroid-018H | Human Thyroid Lysate, Total Protein | +Inquiry |
F10-28S | Native Snake Russells Viper Venom Factor X Activator | +Inquiry |
Chymotrypsin-163B | Active Native Bovine Chymotrypsin | +Inquiry |
FGG-26469TH | Native Human Fibrinogen protein | +Inquiry |
AMY1A-8022H | Native Human Salivary Amylase | +Inquiry |
◆ Cell & Tissue Lysates | ||
DIAPH1-6925HCL | Recombinant Human DIAPH1 293 Cell Lysate | +Inquiry |
VCP-419HCL | Recombinant Human VCP 293 Cell Lysate | +Inquiry |
SMPD3-1651HCL | Recombinant Human SMPD3 cell lysate | +Inquiry |
TYW1-612HCL | Recombinant Human TYW1 293 Cell Lysate | +Inquiry |
S100Z-2085HCL | Recombinant Human S100Z 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Miga2 Products
Required fields are marked with *
My Review for All Miga2 Products
Required fields are marked with *
0
Inquiry Basket