Recombinant Full Length Mouse Protein Fam73A(Fam73A) Protein, His-Tagged
Cat.No. : | RFL8110MF |
Product Overview : | Recombinant Full Length Mouse Protein FAM73A(Fam73a) Protein (Q4QQM5) (1-600aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-600) |
Form : | Lyophilized powder |
AA Sequence : | MSDETVSRSQFSLKTYAVRVFALPVSWYYSLSQIKFSPVAKKLFMVTAVSAVSVIFLAHH FKRRRGKQKGKVLPWEPEHLLLEHTRRAASEKGSSCSSSRQNLTLSLSSTKEKGSQCCNY PNGGLLSRYSGSAQSLGSVQSVNSCHSCACGNSNSWDKADDDDIRLVNIPVTTPENLYLM GMELFEEALRRWEQALTFRSRQAEDEACSSVKLGAGDAIAEESVDDIISSEFIHKLEALL QRAYRLQEEFEATLGGSDPNSIANDTDKDTDMSLRETMDELGLPDAMNMDSADLFASATE LAEQREAQQTFSLESFCPCPFYEEAMHLVEEGKIYSRVLRTEMLECLGDSDFLAKLHCIR QAFQLILAEADNRSFLAESGRKILSALIVKARKNPKKFQDVFDEMINFLEQTDHWDSTEL ELAARGVKNLNFYDVVLDFILMDSFEDLENPPTSIQSVVNNRWLNSSFKESAVASSCWSV LKQKRQQMKISDGFFAHFYAICEHVSPVLAWGFLGPRNSLYDLCCFFKNQVLFFLKDIFD FEKVRYSSIDTLAEDLTHLLIRRTELLVTCLGADALRHATTCTSGHSHAVPTALLEAKVQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Miga1 |
Synonyms | Miga1; Fam73a; Mitoguardin 1; Protein FAM73A |
UniProt ID | Q4QQM5 |
◆ Recombinant Proteins | ||
P2RY12-2459H | Recombinant Human P2RY12 Full Length Transmembrane protein, His-tagged | +Inquiry |
Spike-740V | Active Recombinant COVID-19 Spike Trimer protein(BA.2+L452R, F486V/Omicron), His-tagged | +Inquiry |
Lcat-600M | Recombinant Mouse Lcat protein, His-tagged | +Inquiry |
GDAP1L1-1824R | Recombinant Rhesus monkey GDAP1L1 Protein, His-tagged | +Inquiry |
JMY-12465Z | Recombinant Zebrafish JMY | +Inquiry |
◆ Native Proteins | ||
ACTC1-166B | Active Native bovine ACTC1 | +Inquiry |
Lectin-1739H | Active Native Hippeastrum Hybrid (Amaryllis) Lectin Protein | +Inquiry |
IBVV0400-231I | Native Influenza (B/Victoria/504/00) IBVV0400 protein | +Inquiry |
Lectin-1809M | Active Native Maackia Amurensis Lectin II Protein, Biotinylated | +Inquiry |
ATF-24B | Native Bovine Bovine Apo Transferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNB4-5860HCL | Recombinant Human GNB4 293 Cell Lysate | +Inquiry |
SNRNP25-1625HCL | Recombinant Human SNRNP25 293 Cell Lysate | +Inquiry |
ERBB2-1727MCL | Recombinant Mouse ERBB2 cell lysate | +Inquiry |
FOXJ2-6154HCL | Recombinant Human FOXJ2 293 Cell Lysate | +Inquiry |
GRAMD1B-309HCL | Recombinant Human GRAMD1B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Miga1 Products
Required fields are marked with *
My Review for All Miga1 Products
Required fields are marked with *
0
Inquiry Basket