Recombinant Full Length Mouse Protein Fam134C(Fam134C) Protein, His-Tagged
Cat.No. : | RFL23114MF |
Product Overview : | Recombinant Full Length Mouse Protein FAM134C(Fam134c) Protein (Q9CQV4) (1-466aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-466) |
Form : | Lyophilized powder |
AA Sequence : | MEEAEGVAAAPGPASGLAFRGRRAMSGSWERDQQVEAAQRTLVEVLGPYEPLLSRVQAAL VWERPARSALWCLGLNAAFWFFALTSLRFVFLLAFSLMIIVCIDQWKNKIWPEINVPRPD ALDNESWGFVHPRLLSVPELCHHVAEVWVSGTIFIRNLLLFKKQNPGKFCLLSCGVLTFL AMLGRYIPGLLLSYLMLVIIMMWPLAVYHRLWDRAYVRLKPVLQRLDFSVRGYMMSKQRE RQLRRRALHSERATDSHSDSEEELAAFCPQLDDSTVARELAITDSEHSDAEVSCTENGTF NLSRGQTPLTEGSEDLDGHSDPEESFARDLPDFPSINVDPAGLDDEDDTSIGMPSLMYRS PPGAGDTQVLPASRNEAALPELLLSSLPGGSNLTSNLASLVSQGMIQLALSEASQTDPSG PPPRRATRGFLRAPSSDLDTDAEGDDFELLDQSELNQLDPASSRSH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Retreg3 |
Synonyms | Retreg3; Fam134c; Reticulophagy regulator 3 |
UniProt ID | Q9CQV4 |
◆ Recombinant Proteins | ||
CXCL12-3387H | Recombinant Human CXCL12 Protein, MYC/DDK-tagged | +Inquiry |
CD3E-6754H | Recombinant Human CD3E protein, hFc-Avi-tagged, Biotinylated | +Inquiry |
MRC1-3240H | Recombinant Human MRC1 protein, His-tagged | +Inquiry |
GCA-3475H | Recombinant Human GCA Protein (Met1-Val139), N-His tagged | +Inquiry |
IL3RA-121H | Recombinant Human IL3RA protein, hFc-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1833R | Active Native Ricinus Communis Agglutinin I Protein | +Inquiry |
GOT1-5351H | Native Human Glutamic-Oxaloacetic Transaminase 1, Soluble (aspartate aminotransferase 1) | +Inquiry |
IGHE-214H | Native Human Immunoglobulin E (IgE) | +Inquiry |
AEBP1-8321S | Native S. cerevisiae AEBP1 | +Inquiry |
PLAU -15H | Native Human HMW urokinase, HRP conjugate | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST1H2BK-5537HCL | Recombinant Human HIST1H2BK 293 Cell Lysate | +Inquiry |
Rectum-54H | Human Rectum Tumor Tissue Lysate | +Inquiry |
SLC5A7-1707HCL | Recombinant Human SLC5A7 293 Cell Lysate | +Inquiry |
RSG1-99HCL | Recombinant Human RSG1 lysate | +Inquiry |
Kidney-465C | Cat Kidney Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Retreg3 Products
Required fields are marked with *
My Review for All Retreg3 Products
Required fields are marked with *
0
Inquiry Basket