Recombinant Full Length Mouse Probable G-Protein Coupled Receptor 150(Gpr150) Protein, His-Tagged
Cat.No. : | RFL25214MF |
Product Overview : | Recombinant Full Length Mouse Probable G-protein coupled receptor 150(Gpr150) Protein (Q8BL07) (1-427aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-427) |
Form : | Lyophilized powder |
AA Sequence : | MEDPFSLAILNPASNLSVPTQPSWSLNLTSEQGASVPGPHSPPRGPPSHRIHLVFLGIIL VAAVAGNTTVLCRLCGGSSGPWPGPKRRKMDFLLVQLAAADLYASGGTALSQLAWELLGD PRPALGDLACRLSHLLQASGRGASAHLVALIALERQLAVRIPQGPQLPARALAALSWLLA LLLALPPTFVVRWDAPPSSTANAWPGKHCCRGIFAPLPRWHLQVYALYEAIVGFAAPVAL LGFSCGHLLCVWWQRGSQAPVARMPWSPSMARASLPSALPQAKVQSLKMSLALALLFVGC DLPYFAARLAAAWSSKPAGDWERESLVAAMRVLEVANSAINPLIYLFFQAGDCRLWRRLR RRLGVLCCVREEEADISEWAGDHQALHRHRWPHPHYHHARREERNQGCLRPPPPRPRPPP CSCESAF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gpr150 |
Synonyms | Gpr150; Pgr11; Probable G-protein coupled receptor 150; G-protein coupled receptor PGR11 |
UniProt ID | Q8BL07 |
◆ Recombinant Proteins | ||
Prl-63M | Active Recombinant Mouse Prolactin / Prl Protein | +Inquiry |
NTF4-23H | Recombinant Human Neurotrophin 4 | +Inquiry |
LDH-0124P | Recombinant Plasmodium vivax LDH antigen | +Inquiry |
STATH-224H | Recombinant Human STATH Protein, GST-His-tagged | +Inquiry |
CYP2R1-1156R | Recombinant Rhesus monkey CYP2R1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TNNC1-25H | Native Human TNNC1 protein | +Inquiry |
Lectin-1755C | Active Native Canavalia ensiformis Concanavalin A Protein | +Inquiry |
CKM-5306H | Native Human creatine kinase, muscle | +Inquiry |
Plg-297M | Active Native Mouse Plasmin | +Inquiry |
FGG -47P | Native Porcine Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC31A1-1736HCL | Recombinant Human SLC31A1 293 Cell Lysate | +Inquiry |
CPB-376RM | Rabbit Anti-Mouse IgG Polyclonal Antibody | +Inquiry |
RAB9A-2578HCL | Recombinant Human RAB9A 293 Cell Lysate | +Inquiry |
CYP19A1-7127HCL | Recombinant Human CYP19A1 293 Cell Lysate | +Inquiry |
DNAJC27-6873HCL | Recombinant Human DNAJC27 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gpr150 Products
Required fields are marked with *
My Review for All Gpr150 Products
Required fields are marked with *
0
Inquiry Basket