Recombinant Full Length Mouse Phosphatidate Phosphatase Ppapdc1B(Ppapdc1B) Protein, His-Tagged
Cat.No. : | RFL26970MF |
Product Overview : | Recombinant Full Length Mouse Phosphatidate phosphatase PPAPDC1B(Ppapdc1b) Protein (Q3UMZ3) (1-260aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-260) |
Form : | Lyophilized powder |
AA Sequence : | MGTAALGAELGVRVLLFVAFLVTELLPPFQRRIQPEELWLYRNPYVEAEYFPTGRMFVIA FLTPLSLIFLAKFLRKADATDSKQACLAASLALALNGVFTNIIKLIVGRPRPDFFYRCFP DGLAHSDLTCTGDEDVVNEGRKSFPSGHSSFAFAGLAFASFYLAGKLHCFTPQGRGKSWR LCAFLSPLLFAAVIALSRTCDYKHHWQDVLVGSMIGMTFAYVCYRQYYPPLTDVECHKPF QDKHKLPSSQKPSELHHLEI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Plpp5 |
Synonyms | Plpp5; Phospholipid phosphatase 5 |
UniProt ID | Q3UMZ3 |
◆ Recombinant Proteins | ||
RFL8016PF | Recombinant Full Length Pseudomonas Stutzeri Cobalamin Synthase(Cobs) Protein, His-Tagged | +Inquiry |
ANXA5A-6321Z | Recombinant Zebrafish ANXA5A | +Inquiry |
PYGM-574C | Recombinant Cynomolgus Monkey PYGM Protein, His (Fc)-Avi-tagged | +Inquiry |
Slamf7-2311M | Recombinant Mouse Slamf7 protein, His-tagged | +Inquiry |
RELN-4993R | Recombinant Rat RELN Protein | +Inquiry |
◆ Native Proteins | ||
Skeletal Muscles-012H | Human Skeletal Muscles Lysate, Total Protein | +Inquiry |
RNASE2-171H | Native Human Eosinophil Derived Neurotoxin | +Inquiry |
BGLAP-59B | Native Bovine Osteocalcin | +Inquiry |
PIV1-18 | Native Parainfluenza Virus Type 1 Antigen | +Inquiry |
MMP9-38H | Native Human MMP-9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SULT1A1-1356HCL | Recombinant Human SULT1A1 293 Cell Lysate | +Inquiry |
CHI3L1-1715MCL | Recombinant Mouse CHI3L1 cell lysate | +Inquiry |
SPRR3-1493HCL | Recombinant Human SPRR3 293 Cell Lysate | +Inquiry |
ELANE-2381MCL | Recombinant Mouse ELANE cell lysate | +Inquiry |
SNX9-1584HCL | Recombinant Human SNX9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Plpp5 Products
Required fields are marked with *
My Review for All Plpp5 Products
Required fields are marked with *
0
Inquiry Basket