Recombinant Full Length Mouse Ph And Sec7 Domain-Containing Protein 2(Psd2) Protein, His-Tagged
Cat.No. : | RFL26101MF |
Product Overview : | Recombinant Full Length Mouse PH and SEC7 domain-containing protein 2(Psd2) Protein (Q6P1I6) (1-770aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-770) |
Form : | Lyophilized powder |
AA Sequence : | MDEEKLPCELHKEGSATQEDHGLEPEEEPGLQNGTAASEGLSSHISGPGGEKTLEGTMEP VRGPDVALPGLNLSLTNGLALGQDGNILEDSIEFKTWRSGPAEEEDVPGSPCPDAGDPQL GLDCPGEPDVRDGFSATFEKILESELLRGTQYSSLDSLDVLSLTDESDSCVSFEAPLTPL IQQRARDSPEAGAGLGNGDMGPEGDLGATGGCDGELGSPLRRSISSSRSENVLSHLSLTS VPNGFHEDGPGGSGGDDEDDEDTDKLLNSASDTSLKDGLSDSDSELSSSEGLEPGSTDPL ANGCQGVSEAARRLARRLYHLEGFQRCDVARQLGKNNEFSRLVAGEYLSFFDFSGLTLDR ALRTFLKAFPLMGETQERERVLTHFSRRYCQCNPDDSTSEDGIHTLTCALMLLNTDLHGH NIGKKMSCQQFIANLDQLNDGQDFAKDLLKTLYNSIKNEKLEWAIDEDELRKSLSELVDD KFGTGTKKVTRILDGGNPFLDVPQALNATTYKHGVLTRKTHADMDGKRTPRGRRGWKKFY AVLKGTILYLQKDEYRLDKALSEGDLKNAIRVHHALATRASDYSKKSNVLKLKTADWRVF LFQAPSKEEMLSWILRINLVAAIFSAPAFPAAVSSMKKFCRPLLPSCTTRLCQEEQLRSH ENKLRQVTAELAEHRCHPLERGLKSKEAEEYRLKEHYLTFEKSRYETYIHLLAVKIKVGS DDLERIEARLATIEGDDPALRKTHSSPALSLGHGPVTGSKATKDTSASDT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Psd2 |
Synonyms | Psd2; Efa6c; PH and SEC7 domain-containing protein 2; Exchange factor for ADP-ribosylation factor guanine nucleotide factor 6 C; Exchange factor for ARF6 C; Pleckstrin homology and SEC7 domain-containing protein 2 |
UniProt ID | Q6P1I6 |
◆ Recombinant Proteins | ||
ACTC1-479R | Recombinant Rat ACTC1 Protein | +Inquiry |
USO1-541H | Recombinant Human USO1 Protein, His&GST-tagged | +Inquiry |
CENPM-15887H | Recombinant Human CENPM, His-tagged | +Inquiry |
GSPT2-3331HF | Recombinant Full Length Human GSPT2 Protein, GST-tagged | +Inquiry |
GRM4-2716R | Recombinant Rat GRM4 Protein | +Inquiry |
◆ Native Proteins | ||
OXT-5360H | Native Human Oxytocin, Prepropeptide | +Inquiry |
LH-92P | Native Porcine LH | +Inquiry |
CRP-5330H | Native Canine CRP protein | +Inquiry |
FSHB-81H | Active Native Human FSH | +Inquiry |
TTR-141S | Native Sheep prealbumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLAU-1734HCL | Recombinant Human PLAU cell lysate | +Inquiry |
DEFB103A-464HCL | Recombinant Human DEFB103A cell lysate | +Inquiry |
DEM1-6979HCL | Recombinant Human DEM1 293 Cell Lysate | +Inquiry |
PVRL4-2657HCL | Recombinant Human PVRL4 293 Cell Lysate | +Inquiry |
PCP4-3372HCL | Recombinant Human PCP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Psd2 Products
Required fields are marked with *
My Review for All Psd2 Products
Required fields are marked with *
0
Inquiry Basket