Recombinant Full Length Mouse Olfactory Receptor 490(Olfr490) Protein, His-Tagged
Cat.No. : | RFL2314MF |
Product Overview : | Recombinant Full Length Mouse Olfactory receptor 490(Olfr490) Protein (Q8VFD2) (1-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-314) |
Form : | Lyophilized powder |
AA Sequence : | MAFLENGNHTAVSEFILLGLTDDPVLRIVLFTIILCIYLVTVSGNLSTILLIRVSSQLHH PMYFFLSHLASADIGLSSSVTPNMLVNFLVERSTISYLGCGIQLSSAALFGATECFLLAA MAYDRFMAICNPLLYSTKMSTKVCVQLIVGSYIAGFLNASSFLLSFFSLLFCGQNIINDF FCDFAPLAELSCSDVSVFVVVISFSAGTVTMLTVFVIAISYSYILITILKMRSTEGRQKA FSTCTSHLTAVTLFYGTVTFIYVMPKSSYSMDQNKIISVFYMVVVPMLNPLIYSLRNNEI KGALKRHFDRKTFS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Olfr490 |
Synonyms | Olfr490; Mor204-17; Olfactory receptor 490; Olfactory receptor 204-17 |
UniProt ID | Q8VFD2 |
◆ Native Proteins | ||
Hyaluronidase-35O | Active Native Ovine Hyaluronidase, 300U/mg | +Inquiry |
IgG-018R | Native Rabbit Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
Lectin-1735P | Active Native Peanut Agglutinin Protein, Rhodamine labeled | +Inquiry |
Lectin-1867W | Active Native Succinylated Wheat Germ Agglutinin Protein | +Inquiry |
OMD-137C | Native Chicken Ovomucoid | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAPGEF5-1469HCL | Recombinant Human RAPGEF5 cell lysate | +Inquiry |
GYPB-313HCL | Recombinant Human GYPB lysate | +Inquiry |
PRPF4B-2824HCL | Recombinant Human PRPF4B 293 Cell Lysate | +Inquiry |
NDE1-3938HCL | Recombinant Human NDE1 293 Cell Lysate | +Inquiry |
RAB38-2600HCL | Recombinant Human RAB38 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Olfr490 Products
Required fields are marked with *
My Review for All Olfr490 Products
Required fields are marked with *
0
Inquiry Basket