Recombinant Full Length Mouse Neuropeptide Y Receptor Type 4(Ppyr1) Protein, His-Tagged
Cat.No. : | RFL32542MF |
Product Overview : | Recombinant Full Length Mouse Neuropeptide Y receptor type 4(Ppyr1) Protein (Q61041) (1-375aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-375) |
Form : | Lyophilized powder |
AA Sequence : | MNTSHFLAPLFPGSLQGKNGTNPLDSPYNFSDGCQDSAELLAFIITTYSIETILGVLGNL CLIFVTTRQKEKSNVTNLLIANLAFSDFLMCLICQPLTVTYTIMDYWIFGEVLCKMLTFI QCMSVTVSILSLVLVALERHQLIINPTGWKPSIFQAYLGIVVIWFVSCFLSLPFLANSTL NDLFHYNHSKVVEFLEDKVVCFVSWSSDHHRLIYTTFLLLFQYCIPLAFILVCYIRIYQR LQRQKHVFHAHACSSRAGQMKRINSMLMTMVTAFAVLWLPLHVFNTLEDWYQEAIPACHG NLIFLMCHLLAMASTCVNPFIYGFLNINFKKDIKALVLTCHCRSPRGESEHLPLSTVHTD LSKGSMRMGSKSNFI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Npy4r |
Synonyms | Npy4r; Ppyr1; Neuropeptide Y receptor type 4; NPY4-R; NPYR-D; Pancreatic polypeptide receptor 1; PP1 |
UniProt ID | Q61041 |
◆ Native Proteins | ||
APOC3-8040H | Native Human ApoLipoprotein CIII | +Inquiry |
SNCA-27342TH | Native Human SNCA | +Inquiry |
HB-43R | Native Rat Hemoglobin (HB) Protein | +Inquiry |
Neuraminidase-008C | Active Native Clostridium perfringens Neuraminidase, Type V | +Inquiry |
CKM-368P | Native Pig Creatine Kinase, Muscle | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNAI3-5869HCL | Recombinant Human GNAI3 293 Cell Lysate | +Inquiry |
HSD17B4-5373HCL | Recombinant Human HSD17B4 293 Cell Lysate | +Inquiry |
LIF-1729MCL | Recombinant Mouse LIF cell lysate | +Inquiry |
Ureter-546H | Human Ureter Membrane Tumor Lysate | +Inquiry |
ADORA3-12HCL | Recombinant Human ADORA3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Npy4r Products
Required fields are marked with *
My Review for All Npy4r Products
Required fields are marked with *
0
Inquiry Basket