Recombinant Full Length Mouse Muscarinic Acetylcholine Receptor M4(Chrm4) Protein, His-Tagged
Cat.No. : | RFL17584MF |
Product Overview : | Recombinant Full Length Mouse Muscarinic acetylcholine receptor M4(Chrm4) Protein (P32211) (1-479aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-479) |
Form : | Lyophilized powder |
AA Sequence : | MANFTPVNGSSANQSVRLVTTAHNHLETVEMVFIATVTGSLSLVTVVGNILVMLSIKVNR QLQTVNNYFLFSLACADLIIGAFSMNLYTLYIIKGYWPLGAVVCDLWLALDYVVSNASVM NLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTVP DNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAKT LAFLKSPLMKPSIKKPPPGGASREELRNGKLEEAPPPALPPPPRPVADKDTSNESSSGSA TQNTKERPPTELSTTEAATTPALPAPTLQPRTLNPASKWSKIQIVTKQTGSECVTAIEIV PATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMV LVNTFCQSCIPERVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Chrm4 |
Synonyms | Chrm4; Chrm-4; Muscarinic acetylcholine receptor M4; Mm4 mAChR |
UniProt ID | P32211 |
◆ Recombinant Proteins | ||
CHRM4-861R | Recombinant Rhesus monkey CHRM4 Protein, His-tagged | +Inquiry |
CHRM4-3223HF | Recombinant Full Length Human CHRM4 Protein | +Inquiry |
CHRM4-3427M | Recombinant Mouse CHRM4 Protein | +Inquiry |
RFL22156HF | Recombinant Full Length Human Muscarinic Acetylcholine Receptor M4(Chrm4) Protein, His-Tagged | +Inquiry |
RFL8399RF | Recombinant Full Length Rat Muscarinic Acetylcholine Receptor M4(Chrm4) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Chrm4 Products
Required fields are marked with *
My Review for All Chrm4 Products
Required fields are marked with *
0
Inquiry Basket