Recombinant Full Length Mouse Metalloreductase Steap1(Steap1) Protein, His-Tagged
Cat.No. : | RFL24698MF |
Product Overview : | Recombinant Full Length Mouse Metalloreductase STEAP1(Steap1) Protein (Q9CWR7) (1-339aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-339) |
Form : | Lyophilized powder |
AA Sequence : | MEISDDVTNPEQLWKMKPKGNLEDDSYSTKDSGETSMLKRPGLSHLQHAVHVDAFDCPSE LQHTQEFFPNWRLPVKVAAIISSLTFLYTLLREIIYPLVTSREQYFYKIPILVINKVLPM VAITLLALVYLPGELAAVVQLRNGTKYKKFPPWLDRWMLARKQFGLLSFFFAVLHAVYSL SYPMRRSYRYKLLNWAYKQVQQNKEDAWVEHDVWRMEIYVSLGIVGLAILALLAVTSIPS VSDSLTWREFHYIQSKLGIVSLLLGTVHALVFAWNKWVDVSQFVWYMPPTFMIAVFLPTL VLICKIALCLPCLRKKILKIRCGWEDVSKINRTEMASRL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Steap1 |
Synonyms | Steap1; Steap; Metalloreductase STEAP1; Six-transmembrane epithelial antigen of prostate 1 |
UniProt ID | Q9CWR7 |
◆ Recombinant Proteins | ||
STEAP1-2472H | Recombinant Human STEAP1 Full Length Transmembrane protein, His-SUMO-tagged | +Inquiry |
STEAP1-297H | Active Recombinant Human STEAP1 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
STEAP1-3000H | Recombinant Human STEAP1 protein, His-tagged | +Inquiry |
STEAP1-2899H | Recombinant Human STEAP1 Protein, MYC/DDK-tagged | +Inquiry |
Steap1-6177M | Recombinant Mouse Steap1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STEAP1-1710HCL | Recombinant Human STEAP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Steap1 Products
Required fields are marked with *
My Review for All Steap1 Products
Required fields are marked with *
0
Inquiry Basket