Recombinant Full Length Mouse Lipid Phosphate Phosphatase-Related Protein Type 4(Lppr4) Protein, His-Tagged
Cat.No. : | RFL18103MF |
Product Overview : | Recombinant Full Length Mouse Lipid phosphate phosphatase-related protein type 4(Lppr4) Protein (Q7TME0) (1-766aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-766) |
Form : | Lyophilized powder |
AA Sequence : | MQRAGSSGARGECDISGAGRLRLEQAARLGGRTVHTSPGGGLGARQAAGMSAKERPKGKV IKDSVTLLPCFYFVELPILASSVVSLYFLELTDVFKPVHSGFSCYDRSLSMPYIEPTQEA IPFLMLLSLAFAGPAITIMVGEGILYCCLSKRRNGAGLEPNINAGGCNFNSFLRRAVRFV GVHVFGLCSTALITDIIQLSTGYQAPYFLTVCKPNYTSLNVSCKENSYIVEDICSGSDLT VINSGRKSFPSQHATLAAFAAVYVSMYFNSTLTDSSKLLKPLLVFTFIICGIICGLTRIT QYKNHPVDVYCGFLIGGGIALYLGLYAVGNFLPSEDSMLQHRDALRSLTDLNQDPSRVLS AKNGSSGDGIAHTEGILNRNHRDASSLTNLKRANADVEIITPRSPMGKESMVTFSNTLPR ANTPSVEDPVRRNASIHASMDSARSKQLLTQWKSKNESRKMSLQVMDTEPEGQSPPRSIE MRSSSEPSRVGVNGDHHVPGNQYLKIQPGTVPGCNNSMPGGPRVSIQSRPGSSQLVHIPE ETQENISTSPKSSSARAKWLKAAEKTVACNRSNNQPRIMQVIAMSKQQGVLQSSPKNAEG STVTCTGSIRYKTLTDHEPSGIVRVEAHPENNRPIIQIPSSTEGEGSGSWKWKAPEKSSL RQTYELNDLNRDSESCESLKDSFGSGDRKRSNIDSNEHHHHGITTIRVTPVEGSEIGSET LSVSSSRDSTLRRKGNIILIPERSNSPENTRNIFYKGTSPTRAYKD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Plppr4 |
Synonyms | Plppr4; D3Bwg0562e; Kiaa0455; Lppr4; Php1; Prg1; Phospholipid phosphatase-related protein type 4; Brain-specific phosphatidic acid phosphatase-like protein 1; Lipid phosphate phosphatase-related protein type 4; Plasticity-related gene 1 protein; PRG-1 |
UniProt ID | Q7TME0 |
◆ Recombinant Proteins | ||
GALNT2-4700R | Recombinant Rhizobia GALNT2 Protein | +Inquiry |
SERPINI2-5918H | Recombinant Human SERPINI2 Protein (Ser19-Leu405), C-His tagged | +Inquiry |
CCDC85A-2936M | Recombinant Mouse CCDC85A Protein | +Inquiry |
SUI-0010P2-2460S | Recombinant Staphylococcus aureus (strain: 18809) SUI_0010P2 protein, His-tagged | +Inquiry |
PLK3-11456Z | Recombinant Zebrafish PLK3 | +Inquiry |
◆ Native Proteins | ||
AMBP-5312H | Native Human Alpha-1-Microglobulin/Bikunin Precursor | +Inquiry |
LTF-3211B | Native Bovine Lactoferrin Protein | +Inquiry |
COL1A1-23M | Native Mouse Collagen I Protein | +Inquiry |
Chitosan-004C | Native Crawfish Chitosan Film | +Inquiry |
FABP-173C | Native Canine Fatty acid Binding Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TYRO3-615HCL | Recombinant Human TYRO3 293 Cell Lysate | +Inquiry |
ASAP3-450HCL | Recombinant Human ASAP3 cell lysate | +Inquiry |
BANF1-8518HCL | Recombinant Human BANF1 293 Cell Lysate | +Inquiry |
NSDHL-1223HCL | Recombinant Human NSDHL cell lysate | +Inquiry |
NPR3-3732HCL | Recombinant Human NPR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Plppr4 Products
Required fields are marked with *
My Review for All Plppr4 Products
Required fields are marked with *
0
Inquiry Basket