Recombinant Full Length Mouse Glycerol-3-Phosphate Acyltransferase 3(Agpat9) Protein, His-Tagged
Cat.No. : | RFL11340MF |
Product Overview : | Recombinant Full Length Mouse Glycerol-3-phosphate acyltransferase 3(Agpat9) Protein (Q8C0N2) (1-438aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-438) |
Form : | Lyophilized powder |
AA Sequence : | MEGADLAVKLLSTWLTLVGGLILLPSAFGLSLGISEIYMKILVKTLEWATLRIQKGAPKE SALKNSASVGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEE LVSWNLLTRTNVNFQYISPRLTMVWVLGVLVRYCFLLPLRVTLAFIGISLLIIGTTLVGQ LPDSSLKNWLSELVHLTCCRICVRSLSGTIHYHNKQYRPQKGGICVANHTSPIDVLILAT DGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEIKDRHLVTKRLKEHIADKKKLPILI FPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYNPQFGDAFWNSSKYNLVSYLLRIMTSW AIVCDVWYMPPMTREEGEDAVQFANRVKSAIAVQGGLTELPWDGGLKRAKVKDTFKEEQQ KNYSKMIVGNGSPNLARD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gpat3 |
Synonyms | Gpat3; Agpat9; Glycerol-3-phosphate acyltransferase 3; GPAT-3; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 10; AGPAT 10; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 9; 1-AGP acyltransferase 9; 1-AGPAT 9; Acyl-CoA:glycerol-3-phosphate acyltransfe |
UniProt ID | Q8C0N2 |
◆ Recombinant Proteins | ||
RFL2510HF | Recombinant Full Length Human Olfactory Receptor 13C3(Or13C3) Protein, His-Tagged | +Inquiry |
SPSB-2155B | Recombinant Bacillus subtilis SPSB protein, His-tagged | +Inquiry |
ZFP523-10354M | Recombinant Mouse ZFP523 Protein, His (Fc)-Avi-tagged | +Inquiry |
UBXN10-5083R | Recombinant Rhesus monkey UBXN10 Protein, His-tagged | +Inquiry |
BASP1-601R | Recombinant Rat BASP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Troponin-18H | Native Human Cardiac Troponin complex | +Inquiry |
F10-28S | Native Snake Russells Viper Venom Factor X Activator | +Inquiry |
ORM1-26392TH | Native Human ORM1 | +Inquiry |
IgY-006D | Native Duck IgY | +Inquiry |
AFP-3018P | Native pig AFP | +Inquiry |
◆ Cell & Tissue Lysates | ||
KPNA5-4888HCL | Recombinant Human KPNA5 293 Cell Lysate | +Inquiry |
CPO-7306HCL | Recombinant Human CPO 293 Cell Lysate | +Inquiry |
PECAM1-2798HCL | Recombinant Human PECAM1 cell lysate, His-tagged | +Inquiry |
SP6-1553HCL | Recombinant Human SP6 293 Cell Lysate | +Inquiry |
MLKL-1115HCL | Recombinant Human MLKL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gpat3 Products
Required fields are marked with *
My Review for All Gpat3 Products
Required fields are marked with *
0
Inquiry Basket