Recombinant Full Length Mouse Gap Junction Alpha-8 Protein(Gja8) Protein, His-Tagged
Cat.No. : | RFL32305MF |
Product Overview : | Recombinant Full Length Mouse Gap junction alpha-8 protein(Gja8) Protein (P28236) (2-440aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-440) |
Form : | Lyophilized powder |
AA Sequence : | GDWSFLGNILEEVNEHSTVIGRVWLTVLFIFRILILGTAAEFVWGDEQSDFVCNTQQPGC ENVCYDEAFPISHIRLWVLQIIFVSTPSLMYVGHAVHHVRMEEKRKDREAEELCQQSRSN GGERVPIAPDQASIRKSSSSSKGTKKFRLEGTLLRTYVCHIIFKTLFEVGFIVGHYFLYG FRILPLYRCSRWPCPNVVDCFVSRPTEKTIFILFMLSVAFVSLFLNIMEMSHLGMKGIRS AFKRPVEQPLGEIAEKSLHSIAVSSIQKAKGYQLLEEEKIVSHYFPLTEVGMVETSPLSA KPFSQFEEKIGTGPLADMSRSYQETLPSYAQVGVQEVEREEPPIEEAVEPEVGEKKQEAE KVAPEGQETVAVPDRERVETPGVGKEDEKEELQAEKVTKQGLSAEKAPSLCPELTTDDNR PLSRLSKASSRARSDDLTI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gja8 |
Synonyms | Gja8; Gap junction alpha-8 protein; Connexin-50; Cx50; Lens fiber protein MP70 |
UniProt ID | P28236 |
◆ Recombinant Proteins | ||
GJA8-1535H | Recombinant Human GJA8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GJA8-495H | Recombinant Human GJA8 | +Inquiry |
GJA8-6372M | Recombinant Mouse GJA8 Protein | +Inquiry |
GJA8-3033H | Recombinant Human GJA8 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL8496OF | Recombinant Full Length Sheep Gap Junction Alpha-8 Protein(Gja8) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gja8 Products
Required fields are marked with *
My Review for All Gja8 Products
Required fields are marked with *
0
Inquiry Basket