Recombinant Full Length Mouse G-Protein Coupled Receptor Family C Group 5 Member D(Gprc5D) Protein, His-Tagged
Cat.No. : | RFL32856MF |
Product Overview : | Recombinant Full Length Mouse G-protein coupled receptor family C group 5 member D(Gprc5d) Protein (Q9JIL6) (1-344aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-344) |
Form : | Lyophilized powder |
AA Sequence : | MYEDCVKSTEDYYLFCDNEGPWAIVLESLAVIGIVVTILLLLAFLFLMRKVQDCSQWNVL PTQFLFLLAVLGLFGLTFAFIIQLNHQTAPVRYFLFGVLFAICFSCLLAHASNLVKLVRG RVSFCWTTILFIAIGVSLLQTIIAIEYVTLIMTRGLMFEHMTPYQLNVDFVCLLIYVLFL MALTFFVSKATFCGPCENWKQHGRLIFATVLVSIIIWVVWISMLLRGNPQLQRQPHWDDA VICIGLVTNAWVFLLIYIIPELSILYRSCRQECPTQGNVCQVPVYQRSFRMDTQEPTRAR DSDGAQEDVALTAYGTPIQLQSADPSREYLIPSATLSPQQDAGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gprc5d |
Synonyms | Gprc5d; G-protein coupled receptor family C group 5 member D |
UniProt ID | Q9JIL6 |
◆ Recombinant Proteins | ||
GPRC5D-1488H | Active Recombinant Human GPRC5D protein, Flag-His-tagged | +Inquiry |
GPRC5D-5550HF | Recombinant Full Length Human GPRC5D Protein | +Inquiry |
GPRC5D-502H | Active Recombinant Human GPRC5D protein(VLPs) | +Inquiry |
GPRC5D-552H | Active Recombinant Fluorescent Human GPRC5D Full Length protein(VLPs), GFP-tagged | +Inquiry |
GPRC5D-0294H | Recombinant Human GPRC5D protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPRC5D-749HCL | Recombinant Human GPRC5D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gprc5d Products
Required fields are marked with *
My Review for All Gprc5d Products
Required fields are marked with *
0
Inquiry Basket