Recombinant Full Length Mouse Ephrin-B2(Efnb2) Protein, His-Tagged
Cat.No. : | RFL4749MF |
Product Overview : | Recombinant Full Length Mouse Ephrin-B2(Efnb2) Protein (P52800) (29-336aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (29-336) |
Form : | Lyophilized powder |
AA Sequence : | RSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSARNHGPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNLLGSEVALFAGIASGCIIFIVIIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRGGNNNGSEPSDVIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Efnb2 |
Synonyms | Efnb2; Elf2; Epl5; Eplg5; Htkl; Lerk5; Ephrin-B2; ELF-2; EPH-related receptor tyrosine kinase ligand 5; LERK-5; HTK ligand; HTK-L |
UniProt ID | P52800 |
◆ Recombinant Proteins | ||
EFNB2-6870H | Recombinant Human Ephrin-B2, His-tagged | +Inquiry |
Efnb2-7194M | Recombinant Mouse Efnb2 Protein, His-tagged | +Inquiry |
EFNB2-297C | Active Recombinant Canine EFNB2 protein(Met1-Ala229), hFc-tagged | +Inquiry |
Efnb2-131M | Recombinant Mouse Efnb2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Efnb2-1377M | Recombinant Mouse Efnb2 Protein, Fc/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNB2-936HCL | Recombinant Human EFNB2 cell lysate | +Inquiry |
EFNB2-2405MCL | Recombinant Mouse EFNB2 cell lysate | +Inquiry |
EFNB2-1540RCL | Recombinant Rat EFNB2 cell lysate | +Inquiry |
EFNB2-965CCL | Recombinant Canine EFNB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Efnb2 Products
Required fields are marked with *
My Review for All Efnb2 Products
Required fields are marked with *
0
Inquiry Basket