Recombinant Full Length Mouse Ectonucleoside Triphosphate Diphosphohydrolase 7(Entpd7) Protein, His-Tagged
Cat.No. : | RFL6580MF |
Product Overview : | Recombinant Full Length Mouse Ectonucleoside triphosphate diphosphohydrolase 7(Entpd7) Protein (Q3TCT4) (1-606aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-606) |
Form : | Lyophilized powder |
AA Sequence : | MARISFSYLCPASWYFTVPTVSPFLRQRVAFLGLFFIPCVLLLLLIMDLRHWATSLPRDR QYERYLARVGDLEATNTEDPNLNYGLVVDCGSSGSRIFVYFWPRHNGNPHDLLDIKQMRD RNSQPVVKKIKPGISAMADTPEHASDYLRPLLSFAAAHVPVKKHRETPLYILCTAGMRLL PERQQLAILADLVKDLPLEFDFLFSQSQAEVISGKQEGVYAWIGINFVLGRFDHEDESDS DTSVDSAAGRRRTVGILDMGGASLQIAYEVPTSASDLPPKQEEAAKILLAEFNLGCDVQH TEHVYRVYVTTFLGFGGNFARQRYEDLVLNETLNKNRLLGQKTGLSPDNPFLDPCLPVGL TDMVKRNNQVLHFRGKGDWASCRTLLSPLLARSNTSQASLNGIYQSPIDFNNSEFYGFSE FFYCTEDVLRIGGHYHGPTFAKAAQDYCGMAWPVLAQRFKNGLFSSHADEHRLKYQCFKS AWMYEVLHEGFHFPYDYPNLQTAQLVYDREVQWTLGAILYKTRFLPLRDLRQGQGGVRPA HGSWLRLSFVYNHYLFFACTLVVLLAIVLYLLRIHRIHRRQTRASAPLDLLWIEQVVPMI GVQVGP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Entpd7 |
Synonyms | Entpd7; Kiaa4066; Lalp1; Ectonucleoside triphosphate diphosphohydrolase 7; NTPDase 7; Lysosomal apyrase-like protein 1 |
UniProt ID | Q3TCT4 |
◆ Recombinant Proteins | ||
TNFRSF11B-5853R | Recombinant Rat TNFRSF11B Protein, His (Fc)-Avi-tagged | +Inquiry |
LRIG2-301630H | Recombinant Human LRIG2 protein, GST-tagged | +Inquiry |
PRKG1-413H | Recombinant Full Length Human PRKG1, GST-tagged, Active | +Inquiry |
PRKAR1A-1770C | Recombinant Chicken PRKAR1A | +Inquiry |
BMPR1B-939H | Recombinant Human Bone Morphogenetic Protein Receptor, Type IB, His-tagged | +Inquiry |
◆ Native Proteins | ||
LOC102577615-59P | Native potato LOC102577615 Protein | +Inquiry |
GG-192M | Native Mouse Gamma Globulin protein | +Inquiry |
MMP2-29475TH | Native Human MMP2 | +Inquiry |
B. afzelii-21 | Native Borrelia afzelii Antigen | +Inquiry |
HNMT-1355R | Active Native Rat HNMT Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Dorsal-638B | Bovine Dorsal Root Ganglia Lysate, Total Protein | +Inquiry |
P2RX7-3495HCL | Recombinant Human P2RX7 293 Cell Lysate | +Inquiry |
CIZ1-360HCL | Recombinant Human CIZ1 cell lysate | +Inquiry |
Tonsil-537H | Human Tonsil Membrane Lysate | +Inquiry |
C16orf58-8250HCL | Recombinant Human C16orf58 293 Cell Lysate | +Inquiry |
|
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Entpd7 Products
Required fields are marked with *
My Review for All Entpd7 Products
Required fields are marked with *
0
Inquiry Basket