Recombinant Full Length Mouse Dbh-Like Monooxygenase Protein 1(Moxd1) Protein, His-Tagged
Cat.No. : | RFL29128MF |
Product Overview : | Recombinant Full Length Mouse DBH-like monooxygenase protein 1(Moxd1) Protein (Q9CXI3) (20-613aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-613) |
Form : | Lyophilized powder |
AA Sequence : | SPGRSYPHRVVLDPEGKYWLHWGRQGERLAFRLEVRTNGYVGFGFSPTGSMAAADIVVGG VAHGRPYLQDYFTNADRELEKDAQQDYHLDYAMENSTHTVIEFSRELHTCDVNDKSLTDS TVRVIWAYHHDDPGESGPKYHDLNRGTRSLRLLNPEKANVVSTVLPYFDLVNQNVPIPNK GTTYWCQMFKIPTFQEKHHVIKVEPIIERGHENLVHHILVYQCSSNFNDSVLDFGHECYH PNMPDAFLTCETVILAWGIGGEGFTYPPHVGLSLGMPLDPRYVLLEVHYDNPARRKGLID SSGLRVFHTTDIRRYDAGVIEAGLWVSLFHTIPPGMPEFHSEGHCTLECLEEALGAEKPS GIHVFAVLLHAHLAGKGIRLRHFRKGEEMKLLAYDDDYDFNFQEFQYLREEQTILPGDNL ITECRYNTKDRAVMTWGGLSTRNEMCLSYLLYYPRVNLTRCSSIPDIMEQLQFIGVKEIY RPVTTWPFIIKSPKQYRNLSFMDAMNKFKWTKKEGLSFNKLVLSLPVNVRCSKTDNAEWS IQGMTAIPPDIKRPYEAEPLVCEKAASPPLHGIFSLRLLTCALLLGSMLSSQGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Moxd1 |
Synonyms | Moxd1; Dbhr; Mox; DBH-like monooxygenase protein 1; DBH-related protein; Monooxygenase X |
UniProt ID | Q9CXI3 |
◆ Recombinant Proteins | ||
ZCCHC12-5083R | Recombinant Rhesus Macaque ZCCHC12 Protein, His (Fc)-Avi-tagged | +Inquiry |
MSH5-3788R | Recombinant Rat MSH5 Protein | +Inquiry |
FPGS-4483H | Recombinant Human FPGS Protein, GST-tagged | +Inquiry |
HLA-A&B2M-1556H | Recombinant Human HLA-A&B2M protein, His-Avi-tagged | +Inquiry |
CB2-0855H | Active Recombinant Human CB2 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
◆ Native Proteins | ||
Thromboplastin-079B | Native Bovine Thromboplastin Protein | +Inquiry |
Lectin-1768D | Active Native Datura Stramonium Lectin Protein | +Inquiry |
CRP-4303H | Native Human C-reactive Protein | +Inquiry |
RNASE2-171H | Native Human Eosinophil Derived Neurotoxin | +Inquiry |
HbA1c-20R | Native Rat Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C20orf43-8113HCL | Recombinant Human C20orf43 293 Cell Lysate | +Inquiry |
IFIT2-5287HCL | Recombinant Human IFIT2 293 Cell Lysate | +Inquiry |
PRPF3-2827HCL | Recombinant Human PRPF3 293 Cell Lysate | +Inquiry |
IFNB1-889CCL | Recombinant Cynomolgus IFNB1 cell lysate | +Inquiry |
MAPRE1-4481HCL | Recombinant Human MAPRE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Moxd1 Products
Required fields are marked with *
My Review for All Moxd1 Products
Required fields are marked with *
0
Inquiry Basket