Recombinant Full Length Mouse Coxsackievirus And Adenovirus Receptor Homolog(Cxadr) Protein, His-Tagged
Cat.No. : | RFL30913MF |
Product Overview : | Recombinant Full Length Mouse Coxsackievirus and adenovirus receptor homolog(Cxadr) Protein (P97792) (20-365aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (20-365) |
Form : | Lyophilized powder |
AA Sequence : | LSITTPEQRIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPSDNQIVDQVIILYSGDKIYDNYYPDLKGRVHFTSNDVKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKFLLTVLVKPSGTRCFVDGSEEIGNDFKLKCEPKEGSLPLQFEWQKLSDSQTMPTPWLAEMTSPVISVKNASSEYSGTYSCTVQNRVGSDQCMLRLDVVPPSNRAGTIAGAVIGTLLALVLIGAILFCCHRKRREEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERAPQSPTLAPAKVAAPNLSRMGAVPVMIPAQSKDGSIV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cxadr |
Synonyms | Cxadr; Car; Coxsackievirus and adenovirus receptor homolog; CAR; mCAR |
UniProt ID | P97792 |
◆ Recombinant Proteins | ||
CXADR-3854H | Recombinant Human CXADR protein, His-tagged | +Inquiry |
RFL672HF | Recombinant Full Length Human Coxsackievirus And Adenovirus Receptor(Cxadr) Protein, His-Tagged | +Inquiry |
CXADR-1685R | Recombinant Rat CXADR Protein | +Inquiry |
Cxadr-10532M | Recombinant Mouse Cxadr Protein, His (Fc)-Avi-tagged | +Inquiry |
CXADR-1250H | Recombinant Human CXADR protein, hFc&His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXADR-1102MCL | Recombinant Mouse CXADR cell lysate | +Inquiry |
CXADR-1900HCL | Recombinant Human CXADR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cxadr Products
Required fields are marked with *
My Review for All Cxadr Products
Required fields are marked with *
0
Inquiry Basket