Recombinant Full Length Mouse Cell Cycle Control Protein 50A(Tmem30A) Protein, His-Tagged
Cat.No. : | RFL8353MF |
Product Overview : | Recombinant Full Length Mouse Cell cycle control protein 50A(Tmem30a) Protein (Q8VEK0) (2-364aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-364) |
Form : | Lyophilized powder |
AA Sequence : | AMNYSAKDEVDGGPAGPPGGAAKTRRPDNTAFKQQRLPAWQPILTAGTVLPTFFIIGLIF IPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPNVTSCACTINFTLKQSFEGNVFMY YGLSNFYQNHRRYVKSRDDSQLNGDPSALLNPSKECEPYRRNEDRPIAPCGAIANSMFND TLELYLVANESDPKPIPIPLKKKGIAWWTDKNVKFRNPPGKESLEEKFKDTIKPVNWHKA VYELDPEDESNNGFINEDFIVWMRTAALPTFRKLYRLIERRDDLHPTLPAGQYFLNITYN YPVHSFDGRKRMILSTISWMGGKNPFLGIAYITIGSISFLLGVVLLVINHKYRNSSNTAD ITI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem30a |
Synonyms | Tmem30a; Cdc50a; D9Wsu20e; Cell cycle control protein 50A; P4-ATPase flippase complex beta subunit TMEM30A; Transmembrane protein 30A |
UniProt ID | Q8VEK0 |
◆ Recombinant Proteins | ||
BPIFB1-3783H | Recombinant Human BPIFB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MLLT3-266H | Recombinant Human MLLT3 protein, GST-tagged | +Inquiry |
NMRAL1-6599HF | Recombinant Full Length Human NMRAL1 Protein, GST-tagged | +Inquiry |
Cblb-1974M | Recombinant Mouse Cblb Protein, Myc/DDK-tagged | +Inquiry |
RFL30905RF | Recombinant Full Length Rat Potassium Voltage-Gated Channel Subfamily S Member 2(Kcns2) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Collagen type I-02H | Native Human Collagen type I Protein | +Inquiry |
Histone-52C | Native Calf Histone | +Inquiry |
PROS1-31218TH | Native Human PROS1 Protein | +Inquiry |
POPG-42 | Active Native Pyruvate oxidase | +Inquiry |
LTF-3211B | Native Bovine Lactoferrin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLK1S1-3105HCL | Recombinant Human PLK1S1 293 Cell Lysate | +Inquiry |
PPIL3-2966HCL | Recombinant Human PPIL3 293 Cell Lysate | +Inquiry |
CALM3-7888HCL | Recombinant Human CALM3 293 Cell Lysate | +Inquiry |
NDUFA2-3921HCL | Recombinant Human NDUFA2 293 Cell Lysate | +Inquiry |
PKM2-3153HCL | Recombinant Human PKM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Tmem30a Products
Required fields are marked with *
My Review for All Tmem30a Products
Required fields are marked with *
0
Inquiry Basket