Recombinant Full Length Mouse C-C Chemokine Receptor Type 10(Ccr10) Protein, His-Tagged
Cat.No. : | RFL9786MF |
Product Overview : | Recombinant Full Length Mouse C-C chemokine receptor type 10(Ccr10) Protein (Q9JL21) (1-362aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-362) |
Form : | Lyophilized powder |
AA Sequence : | MGTKPTEQVSWGLYSGYDEEAYSVGPLPELCYKADVQAFSRAFQPSVSLMVAVLGLAGNG LVLATHLAARRTTRSPTSVHLLQLALADLLLALTLPFAAAGALQGWNLGSTTCRAISGLY SASFHAGFLFLACISADRYVAIARALPAGQRPSTPSRAHLVSVFVWLLSLFLALPALLFS RDGPREGQRRCRLIFPESLTQTVKGASAVAQVVLGFALPLGVMAACYALLGRTLLAARGP ERRRALRVVVALVVAFVVLQLPYSLALLLDTADLLAARERSCSSSKRKDLALLVTGGLTL VRCSLNPVLYAFLGLRFRRDLRRLLQGGGCSPKPNPRGRCPRRLRLSSCSAPTETHSLSW DN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ccr10 |
Synonyms | Ccr10; Cmkbr9; Gpr2; C-C chemokine receptor type 10; C-C CKR-10; CC-CKR-10; CCR-10; Chemokine C-C receptor 9; G-protein coupled receptor 2 |
UniProt ID | Q9JL21 |
◆ Recombinant Proteins | ||
CCR10-3000HF | Recombinant Full Length Human CCR10 Protein | +Inquiry |
CCR10-1268R | Recombinant Rat CCR10 protein, His-tagged | +Inquiry |
CCR10-3003HF | Recombinant Full Length Human CCR10 Protein, GST-tagged | +Inquiry |
CCR10-782Z | Recombinant Zebrafish CCR10 | +Inquiry |
CCR10-0879H | Recombinant Human CCR10 Protein (Met1-Ser78), N-GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCR10-7697HCL | Recombinant Human CCR10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccr10 Products
Required fields are marked with *
My Review for All Ccr10 Products
Required fields are marked with *
0
Inquiry Basket