Recombinant Full Length Mouse Atpase Family Aaa Domain-Containing Protein 3(Atad3) Protein, His-Tagged
Cat.No. : | RFL33310MF |
Product Overview : | Recombinant Full Length Mouse ATPase family AAA domain-containing protein 3(Atad3) Protein (Q925I1) (1-591aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-591) |
Form : | Lyophilized powder |
AA Sequence : | MSWLFGIKGPKGEGTGPPLPLPPAQPGAEGGGDRGAGDRPSPKDKWSNFDPTGLERAAKA ARELEHSRHAKEALSLAQMQEQTLQLEQQSKLKEYEAAVEQLKSEQIRVQAEERRKTLTE ETRQHQARAQYQDKLARQRYEDQLKQQQLLNEENLRKQEESVQKQEAIRRATVEREMELR HKNEMLRVEAEARARAKADRENADIIREQIRLKAAEHRQTILESIRTAGTLLGEGFRAFV TDWDKVTATVAGLTLLAVGVYSAKNATSVAGRYIEARLGKPSLVRETSRISVLEALRHPI QVSRRLVSRPQDALEGVILSPSLEARVRDIAIATRNTKKNKSLYRNVLMYGPPGTGKTLF AKKLALHSGMDYAIMTGGDVAPMGREGVTAMHKVFDWASTSRRGLLLFVDEADAFLRKRA TEKISEDLRATLNAFLHRTGQHSSKFMLVLASNQPEQFDWAINDRIDEMVCFALPQREER ERLVRMYFDKYVLKPATEGKQRLKVAQFDYGKKCSEVAQLTEGMSGREIAQLAVAWQAMA YSSEDGVLTEAMMDARVQDAVQQHQQKMQWLKVERPDSQTNKPPHPSLLSC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Atad3 |
Synonyms | Atad3; Atad3a; Kiaa1273; ATPase family AAA domain-containing protein 3; AAA-ATPase TOB3 |
UniProt ID | Q925I1 |
◆ Recombinant Proteins | ||
EXT1-2908M | Recombinant Mouse EXT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL4369EF | Recombinant Full Length Escherichia Coli Pilin(Traa) Protein, His-Tagged | +Inquiry |
EIF3I-12234Z | Recombinant Zebrafish EIF3I | +Inquiry |
DGKZ-1515R | Recombinant Rat DGKZ Protein, His (Fc)-Avi-tagged | +Inquiry |
CTDSPLB-4508Z | Recombinant Zebrafish CTDSPLB | +Inquiry |
◆ Native Proteins | ||
MB-4460H | Native Human Myoglobin | +Inquiry |
Collagen-120B | Native Bovine Type I Collagen, FITC-tagged | +Inquiry |
CEase-21P | Active Native Porcine Cholesterol esterase | +Inquiry |
ACTA1-854P | Native Porcine ACTA1 Protein | +Inquiry |
Collagen-57H | Native Human Collagen Type II | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOF-8779HCL | Recombinant Human APOF 293 Cell Lysate | +Inquiry |
STK16-1408HCL | Recombinant Human STK16 293 Cell Lysate | +Inquiry |
SPATA33-8252HCL | Recombinant Human C16orf55 293 Cell Lysate | +Inquiry |
TMEM92-924HCL | Recombinant Human TMEM92 293 Cell Lysate | +Inquiry |
TFE3-1129HCL | Recombinant Human TFE3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Atad3 Products
Required fields are marked with *
My Review for All Atad3 Products
Required fields are marked with *
0
Inquiry Basket