Recombinant Full Length Mouse Aquaporin-3(Aqp3) Protein, His-Tagged
Cat.No. : | RFL12661MF |
Product Overview : | Recombinant Full Length Mouse Aquaporin-3(Aqp3) Protein (Q8R2N1) (1-292aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-292) |
Form : | Lyophilized powder |
AA Sequence : | MGRQKELMNRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLGILVAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYALAQTLGAFLGAGIVFGLYYDAIWAFANNELFVSGPNGTAGIFATYPSGHLDMVNGFFDQFIGTAALIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSEVFTTGRHWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSTEEENVKLAHMKHKEQI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Aqp3 |
Synonyms | Aqp3; Aquaporin-3; AQP-3; Aquaglyceroporin-3 |
UniProt ID | Q8R2N1 |
◆ Recombinant Proteins | ||
Aqp3-3598R | Recombinant Rat Aqp3, His-tagged | +Inquiry |
RFL1687BF | Recombinant Full Length Bovine Aquaporin-3(Aqp3) Protein, Tag-Free | +Inquiry |
AQP3-3599P | Recombinant Pig AQP3, His-tagged | +Inquiry |
AQP3-6031H | Recombinant Human AQP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
AQP3-649M | Recombinant Mouse AQP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AQP3-8767HCL | Recombinant Human AQP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Aqp3 Products
Required fields are marked with *
My Review for All Aqp3 Products
Required fields are marked with *
0
Inquiry Basket