Recombinant Full Length Morus Indica Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged
Cat.No. : | RFL32873MF |
Product Overview : | Recombinant Full Length Morus indica Photosystem II CP43 chlorophyll apoprotein(psbC) Protein (Q09X21) (15-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Morus indica (Mulberry) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (15-473) |
Form : | Lyophilized powder |
AA Sequence : | TLFNGTLALAGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAH FVPEKPMYEQGLILLPHLATLGWGVGPGGEVLDTFPYFVSGVLHLISSAVLGFGGIYHAL LGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGIGAFLLVFKALYFGGVYDTWAPGGG DVRKITNLTLSPSIVFGYLLKSPFGGEGWIVSVDDLEDIIGGHVWLGSICILGGIWHILT KPFAWARRALVWSGEAYLSYSLGALSIFGFVACCFVWFNNTAYPSEFYGPTGPEASQAQA FTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNG LDLSRLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLATSHFVLG FFLFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbC |
Synonyms | psbC; MoinCp017; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43 |
UniProt ID | Q09X21 |
◆ Recombinant Proteins | ||
GRK4-7280M | Recombinant Mouse GRK4 Protein | +Inquiry |
HIVEP2-2515R | Recombinant Rat HIVEP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL33964MF | Recombinant Full Length Mouse Lipase Maturation Factor 1(Lmf1) Protein, His-Tagged | +Inquiry |
LANCL2-8947M | Recombinant Mouse LANCL2 Protein | +Inquiry |
SH-RS09535-5372S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS09535 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG2-229H | Native Human Immunoglobulin G2 (IgG2) | +Inquiry |
CVF-01I | Native purified cobra venom factor | +Inquiry |
MMP8-89H | Native Human Pro-MMP-8 | +Inquiry |
PLG-1867B | Native Bovine PLG Protein | +Inquiry |
CKMM-382H | Native Human Creatine Kinase MM (CK-MM) | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM106C-1015HCL | Recombinant Human TMEM106C 293 Cell Lysate | +Inquiry |
CASR-7825HCL | Recombinant Human CASR 293 Cell Lysate | +Inquiry |
Cerebellum-67H | Human Cerebellum (RT) Membrane Lysate | +Inquiry |
PTGR2-2707HCL | Recombinant Human PTGR2 293 Cell Lysate | +Inquiry |
COX5B-7332HCL | Recombinant Human COX5B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbC Products
Required fields are marked with *
My Review for All psbC Products
Required fields are marked with *
0
Inquiry Basket