Recombinant Full Length Morus Indica Cytochrome B6(Petb) Protein, His-Tagged
Cat.No. : | RFL19738MF |
Product Overview : | Recombinant Full Length Morus indica Cytochrome b6(petB) Protein (Q09WY7) (1-215aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Morus indica (Mulberry) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-215) |
Form : | Lyophilized powder |
AA Sequence : | MSKIYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTETNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | petB |
Synonyms | petB; MoinCp051; Cytochrome b6 |
UniProt ID | Q09WY7 |
◆ Native Proteins | ||
CEN-27 | Active Native Cholesterol esterase | +Inquiry |
IGFBP1-612H | Native Human Insulin-like Growth Factor Binding Protein 1 | +Inquiry |
Collagen Type I-02M | Native Mouse Collagen Type I (Atelocollagen) Protein | +Inquiry |
CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
ACTA1-854P | Native Porcine ACTA1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTA2-9066HCL | Recombinant Human ACTA2 293 Cell Lysate | +Inquiry |
UMPS-503HCL | Recombinant Human UMPS 293 Cell Lysate | +Inquiry |
ARL15-8718HCL | Recombinant Human ARL15 293 Cell Lysate | +Inquiry |
ARPC5L-128HCL | Recombinant Human ARPC5L cell lysate | +Inquiry |
IL22-5232HCL | Recombinant Human IL22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All petB Products
Required fields are marked with *
My Review for All petB Products
Required fields are marked with *
0
Inquiry Basket