Recombinant Full Length Molybdenum Transport System Permease Protein Modb(Modb) Protein, His-Tagged
Cat.No. : | RFL28246AF |
Product Overview : | Recombinant Full Length Molybdenum transport system permease protein modB(modB) Protein (P37731) (1-226aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Azotobacter vinelandii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-226) |
Form : | Lyophilized powder |
AA Sequence : | MPLSEHDLAAIRLTLELASLTTVLLLVVGTPIAWWLARTRSRLKGAIGAVVALPLVLPPT VLGFYLLVTMGPHGPIGQLTQFLGLGTLPFTFAGLVVASVFYSLPFVVQPLQNAFEAIGE RPLEVASTLRAGPWDTFFTVVVPLARPGFITAAILGFAHTVGEFGVVLMIGGNIPEKTRT VAVQIFDHVEAMEYAQAHWLAGGMVLFSFLVLFALYSSRRFKAGLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | modB |
Synonyms | modB; modC; Molybdenum transport system permease protein ModB |
UniProt ID | P37731 |
◆ Recombinant Proteins | ||
GHRH-132H | Recombinant Human GHRH protein, Fc-tagged | +Inquiry |
YY2-102H | Recombinant Human YY2 Protein, MYC/DDK-tagged | +Inquiry |
SLC33A1-0854H | Recombinant Human SLC33A1 Protein (S2-N549), 8×His-MBP, Flag tagged | +Inquiry |
RFL15280AF | Recombinant Full Length Astyanax Fasciatus Blue-Sensitive Opsin(B23) Protein, His-Tagged | +Inquiry |
LEF1-8995Z | Recombinant Zebrafish LEF1 | +Inquiry |
◆ Native Proteins | ||
IgG-150G | Native Goat IgG Fab fragment | +Inquiry |
PLAU-31687TH | Native Human PLAU | +Inquiry |
IgG-354G | Native Guinea Pig IgG | +Inquiry |
C3-05M | Native Mouse C3 Protein | +Inquiry |
ApoC-I-3557H | Native Human ApoC-I | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUDCD3-3657HCL | Recombinant Human NUDCD3 293 Cell Lysate | +Inquiry |
MCOLN3-4413HCL | Recombinant Human MCOLN3 293 Cell Lysate | +Inquiry |
ASAH1-8670HCL | Recombinant Human ASAH1 293 Cell Lysate | +Inquiry |
CRISPLD2-402HCL | Recombinant Human CRISPLD2 cell lysate | +Inquiry |
C2orf44-8078HCL | Recombinant Human C2orf44 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All modB Products
Required fields are marked with *
My Review for All modB Products
Required fields are marked with *
0
Inquiry Basket