Recombinant Full Length Microcebus Simmonsi Nadh-Ubiquinone Oxidoreductase Chain 4L(Mt-Nd4L) Protein, His-Tagged
Cat.No. : | RFL11998MF |
Product Overview : | Recombinant Full Length Microcebus simmonsi NADH-ubiquinone oxidoreductase chain 4L(MT-ND4L) Protein (Q591M6) (1-98aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Microcebus simmonsi (Simmons's mouse lemur) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-98) |
Form : | Lyophilized powder |
AA Sequence : | MPSISININLAFATALLGMLMFRSHMMSSLLCLEGMMLSMFILSTLTILNMQFTMSFTMP ILLLVFAACEAAIGLALLVMVSNNYGLDYIQNLNLLQC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MT-ND4L |
Synonyms | MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L |
UniProt ID | Q591M6 |
◆ Recombinant Proteins | ||
PIVKA-II-0105H | Recombinant Human PIVKA-II antigen | +Inquiry |
GFAP-02H | Recombinant Human GFAP Protein, DYKDDDDK-tagged | +Inquiry |
DPP4-793H | Recombinant Human DPP4 Protein | +Inquiry |
LILRB1-109H | Recombinant Human LILRB1 protein, His-tagged, Biotinylated | +Inquiry |
RFL3946TF | Recombinant Full Length Thermotoga Maritima Uncharacterized Abc Transporter Atp-Binding Protein Tm_0288(Tm_0288) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
CXCL9-30233TH | Native Human CXCL9 | +Inquiry |
TroponinCIT-33HFL | Native Full Length Human Cardiac Troponin C-I-T Complex | +Inquiry |
CA2-31M | Native Mouse Carbonic Anhydrase II (CA2) Protein | +Inquiry |
CFI-105H | Active Native Human Factor I | +Inquiry |
ALPL-5324H | Active Native Human Alkaline Phosphatase | +Inquiry |
◆ Cell & Tissue Lysates | ||
JUP-5094HCL | Recombinant Human JUP 293 Cell Lysate | +Inquiry |
PDPK1-3322HCL | Recombinant Human PDPK1 293 Cell Lysate | +Inquiry |
Colon-90B | Bovine Colon Lysate | +Inquiry |
CRTC1-202HCL | Recombinant Human CRTC1 lysate | +Inquiry |
C15orf40-8266HCL | Recombinant Human C15orf40 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MT-ND4L Products
Required fields are marked with *
My Review for All MT-ND4L Products
Required fields are marked with *
0
Inquiry Basket