Recombinant Full Length Meyerozyma Guilliermondii Solute Carrier Family 25 Member 38 Homolog (Pgug_00074) Protein, His-Tagged
Cat.No. : | RFL17456MF |
Product Overview : | Recombinant Full Length Meyerozyma guilliermondii Solute carrier family 25 member 38 homolog (PGUG_00074) Protein (A5D9W9) (1-317aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Meyerozyma guilliermondii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-317) |
Form : | Lyophilized powder |
AA Sequence : | MASTTPEVKPGTTLHLLAGSSAGLISAFTLQPFDLLKTRLQQQQRANVGYRSSISRELKK LARFKDLWRGALPSTLRTSVGAGLYFTILSQTRTYVAQLRARTDKLPHSQTSVLPKLSAL DNLSAGFVVRAVVGFITMPITIIKTRFESNMYNYNSMYEGVEGIYLDGKEKGSLRNFFKG TIATLARDCPYAGLYVLFYESMKNEFVPKTLILFDQQEQLENSTLVNSSAAVVASSLATT ITAPFDAIKTRLQLDSHTVGGNSIMSVTKQLLKEDGGVRNLFRGLSLRFGRKGLSAAISW CIYEELLKSGRLQRLLH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PGUG_00074 |
Synonyms | PGUG_00074; Mitochondrial glycine transporter; Solute carrier family 25 member 38 homolog |
UniProt ID | A5D9W9 |
◆ Recombinant Proteins | ||
CYB5R1-4125M | Recombinant Mouse CYB5R1 Protein | +Inquiry |
SPTLC2-15956M | Recombinant Mouse SPTLC2 Protein | +Inquiry |
FBXO41-2928H | Recombinant Human FBXO41 Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF4G2-3683H | Recombinant Human EIF4G2 protein, His-tagged | +Inquiry |
YY1B-12339Z | Recombinant Zebrafish YY1B | +Inquiry |
◆ Native Proteins | ||
ACTA1-854P | Native Porcine ACTA1 Protein | +Inquiry |
Adv2-10 | Native Adenovirus Type 2 Hexon Antigen | +Inquiry |
HSP90AA1-14H | Native Hsp90 Protein | +Inquiry |
APOC3-8040H | Native Human ApoLipoprotein CIII | +Inquiry |
ALA-02B | Native Bovine α-Lactalbumin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCDHB16-1298HCL | Recombinant Human PCDHB16 cell lysate | +Inquiry |
GNLY-5845HCL | Recombinant Human GNLY 293 Cell Lysate | +Inquiry |
CCDC53-7761HCL | Recombinant Human CCDC53 293 Cell Lysate | +Inquiry |
E2F3-6742HCL | Recombinant Human E2F3 293 Cell Lysate | +Inquiry |
EPS15-6578HCL | Recombinant Human EPS15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PGUG_00074 Products
Required fields are marked with *
My Review for All PGUG_00074 Products
Required fields are marked with *
0
Inquiry Basket