Recombinant Full Length Meyerozyma Guilliermondii Sensitive To High Expression Protein 9 Homolog, Mitochondrial(She9) Protein, His-Tagged
Cat.No. : | RFL23855MF |
Product Overview : | Recombinant Full Length Meyerozyma guilliermondii Sensitive to high expression protein 9 homolog, mitochondrial(SHE9) Protein (A5DI86) (36-440aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Meyerozyma guilliermondii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (36-440) |
Form : | Lyophilized powder |
AA Sequence : | IRLCAGRSQYLAATCTPSRFVNKFQVRSSSNSKNIDDKLQTIIDSSNLGAVKKQNEANNK SRNASDTVNDTNTAIPSSSETFHQANADEHTISESTKRAILAENPTLPSQRERLRTETSK RIETYLESLQKTIFRATRTLNDATGYSSIEGLKNEVEKLEIELRRAKTTVKECKKAYTDA ISVRSQSQQEVNELLTRKHNWSPSDLERFTELYRNDHTNEQLEAEAARKLTDAESKVDSI QLKLTQSILTRYHEEQIWSDKIRSASTWGTWVIMGINVLLFFVATLIVEPWKRKRLVASF EDKVKVAISEVNLSNTDSVVEKNTIPAPEASALNETSFSSQISLEPSLLSLSWSQWTWTK FSNYVKSTTSRVLYGNGEIQAIDARLLLVISTFLGCILGNILSGR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SHE9 |
Synonyms | SHE9; PGUG_02987; Sensitive to high expression protein 9 homolog, mitochondrial |
UniProt ID | A5DI86 |
◆ Recombinant Proteins | ||
SLC22A18-5171H | Recombinant Human SLC22A18 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SOD1-8568M | Recombinant Mouse SOD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SE0375-3101S | Recombinant Staphylococcus epidermidis ATCC 12228 SE0375 protein, His-tagged | +Inquiry |
HA0-754I | Recombinant Influenza B (B/PHUKET/3073/2013) HA0 Protein (Met1-Leu584) | +Inquiry |
PHTF2-454Z | Recombinant Zebrafish PHTF2 | +Inquiry |
◆ Native Proteins | ||
Collagen Type III-07H | Native Human Collagen Type III | +Inquiry |
Plasmin-250H | Active Native Human Plasmin | +Inquiry |
BCC-162B | Native Bovine Cholesterol Concentrate | +Inquiry |
Hp-8155M | Native Mouse Serum Haptoglobin | +Inquiry |
CXCL9-30233TH | Native Human CXCL9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSEN34-721HCL | Recombinant Human TSEN34 293 Cell Lysate | +Inquiry |
IL13RA1-2627MCL | Recombinant Mouse IL13RA1 cell lysate | +Inquiry |
Fetal Liver-147H | Human Fetal Liver Lysate | +Inquiry |
MCCC1-4429HCL | Recombinant Human MCCC1 293 Cell Lysate | +Inquiry |
SIX3-1823HCL | Recombinant Human SIX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SHE9 Products
Required fields are marked with *
My Review for All SHE9 Products
Required fields are marked with *
0
Inquiry Basket