Recombinant Full Length Methylamine Utilization Protein Maue(Maue) Protein, His-Tagged
Cat.No. : | RFL36172PF |
Product Overview : | Recombinant Full Length Methylamine utilization protein mauE(mauE) Protein (P29896) (1-186aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Paracoccus denitrificans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-186) |
Form : | Lyophilized powder |
AA Sequence : | MADFLIQPMVLWALRIFLALLFVAAALSKLRHVEEFYGVVRNFRVLPDLASRVVALVLPV VEAAVAVGLVVTPLAVPAAVAAAALLLVFAAALAINVLRGRTQIDCGCFRNGLKQPVSWL LVLRNLVLTALALAIATGLPAAVPASLTEGATGLLAGATAMLIYLSASLLGGLSAAQTAN KTAKGR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mauE |
Synonyms | mauE; Methylamine utilization protein MauE |
UniProt ID | P29896 |
◆ Native Proteins | ||
MG-41H | Active Native Human MG | +Inquiry |
LTF-175H | Native Human lactoferrin | +Inquiry |
CFB-104H | Native Human Factor B | +Inquiry |
F10-290M | Active Native Mouse Factor X | +Inquiry |
APOC3-8040H | Native Human ApoLipoprotein CIII | +Inquiry |
◆ Cell & Tissue Lysates | ||
AADAT-9158HCL | Recombinant Human AADAT 293 Cell Lysate | +Inquiry |
RAB9B-2577HCL | Recombinant Human RAB9B 293 Cell Lysate | +Inquiry |
SENP7-1971HCL | Recombinant Human SENP7 293 Cell Lysate | +Inquiry |
CKB-001HCL | Recombinant Human CKB cell lysate | +Inquiry |
ZNF22-1995HCL | Recombinant Human ZNF22 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mauE Products
Required fields are marked with *
My Review for All mauE Products
Required fields are marked with *
0
Inquiry Basket