Recombinant Full Length Methanocaldococcus Jannaschii Upf0252 Protein Mjecl39(Mjecl39) Protein, His-Tagged
Cat.No. : | RFL27064MF |
Product Overview : | Recombinant Full Length Methanocaldococcus jannaschii UPF0252 protein MJECL39(MJECL39) Protein (Q60294) (1-351aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanocaldococcus jannaschii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-351) |
Form : | Lyophilized powder |
AA Sequence : | MPILLEHIQLNDEDLKDTKHLAEILKYKNNSIKTIINVLEWEDSNIRYCYEKSNVYYFIT FFIIVGLVWAIFPEVWLWCEQVFCISPTIHIIICCLYFIITIILFLFLCGVVGTFLHLWA TFFTLSKCDSKILKLKEGLFTTLSLIWISTSLKTILKTKYAICRDYAKLTSAILHNLNIK HYFLVYPTHVAVAVKIDDYYYVIDQKLPIYKIDVWLKKLGKEKVKIYTPVDIYNSKLKFV EKYYKNENNLKSEISDDILRKIEEDVKKELQIKNAEQYNKKVEPIPVKLSIPIENYDEIT HYSIVRVISKEIYNKFLTNIKNVSNIEIKKDEGKFAVNVYYEIPNSIPNSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MJECL39 |
Synonyms | MJECL39; UPF0252 protein MJECL39 |
UniProt ID | Q60294 |
◆ Recombinant Proteins | ||
WDR44-5836Z | Recombinant Zebrafish WDR44 | +Inquiry |
SP1-4417R | Recombinant Rhesus monkey SP1 Protein, His-tagged | +Inquiry |
HSPE1-MOB4-3129H | Recombinant Human HSPE1-MOB4 Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF4A2-3195H | Recombinant Human EIF4A2 Protein, GST-tagged | +Inquiry |
PPARD-1087H | Active Recombinant Human Peroxisome Proliferator-activated Receptor Delta | +Inquiry |
◆ Native Proteins | ||
BCHE-8054H | Native Human Serum ButyrylcholinEsterase | +Inquiry |
AZU1-40H | Native Human Azurocidin | +Inquiry |
Collagen-120B | Native Bovine Type I Collagen, FITC-tagged | +Inquiry |
TF-5341H | Native Human Transferring | +Inquiry |
LDH5-8342H | Native Human LDH5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOSL1-6166HCL | Recombinant Human FOSL1 293 Cell Lysate | +Inquiry |
OTX2-3511HCL | Recombinant Human OTX2 293 Cell Lysate | +Inquiry |
IL6ST-935HCL | Recombinant Human IL6ST cell lysate | +Inquiry |
SOX13-1563HCL | Recombinant Human SOX13 293 Cell Lysate | +Inquiry |
FAM216A-8327HCL | Recombinant Human C12orf24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MJECL39 Products
Required fields are marked with *
My Review for All MJECL39 Products
Required fields are marked with *
0
Inquiry Basket