Recombinant Full Length Methanocaldococcus Jannaschii Upf0118 Membrane Protein Mj1177(Mj1177) Protein, His-Tagged
Cat.No. : | RFL12857MF |
Product Overview : | Recombinant Full Length Methanocaldococcus jannaschii UPF0118 membrane protein MJ1177(MJ1177) Protein (Q58578) (1-334aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanocaldococcus jannaschii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-334) |
Form : | Lyophilized powder |
AA Sequence : | MRFEEFKYVRKGVIVGLLIMLLYIIWPFIDVLAYSCAFAYMALPVYNILRKKFNKTISAG LAISIYILPIMTITIYALLTFMEIILSFNTKSIEPYINEILSIYNSFMLERIINNEQIIA KYIDEFIKYLVSQFSGKIIDVGYLIVKVIMVLFLTFYFLRDGDKAKNLIISFVPDEYKEK MRIYLSYLHDSYKNLFISCVSLSIIITILSYIGYLILGVPYAELFAIITGIFALLPILGG WMVYISIAIYFFLIHDYTKAVFMFIYGELFLSIAPDFVIRPYLVKKEVDIHPVLVVIAFL MAPLSLGLSGFAIGPLVVGALNAFYLAKYRDKKI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MJ1177 |
Synonyms | MJ1177; Putative transport protein MJ1177 |
UniProt ID | Q58578 |
◆ Recombinant Proteins | ||
SLX4-8455M | Recombinant Mouse SLX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC151-4703Z | Recombinant Zebrafish CCDC151 | +Inquiry |
PNRC2-13051M | Recombinant Mouse PNRC2 Protein | +Inquiry |
RUVBL2-4977H | Recombinant Human RUVBL2 protein, His-SUMO-tagged | +Inquiry |
Omega-gliadin-5698C | Recombinant Crithodium monococcum Omega-gliadin protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Fgg -65R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
Thromboplastin-078R | Native Rabbit Thromboplastin Protein | +Inquiry |
C1QA-26126TH | Native Human C1QA | +Inquiry |
Collagen Type I-11M | Native Mouse Collagen Type I Protein | +Inquiry |
Lectin-1855V | Active Native Vicia Villosa Lectin Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
BPI-1493HCL | Recombinant Human BPI cell lysate | +Inquiry |
WBP2-366HCL | Recombinant Human WBP2 293 Cell Lysate | +Inquiry |
ICOSLG-2804MCL | Recombinant Mouse ICOSLG Overexpression Lysate(Met 1-Lys 279) | +Inquiry |
MAD2L1BP-4569HCL | Recombinant Human MAD2L1BP 293 Cell Lysate | +Inquiry |
CD40LG-1205RCL | Recombinant Rat CD40LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MJ1177 Products
Required fields are marked with *
My Review for All MJ1177 Products
Required fields are marked with *
0
Inquiry Basket