Recombinant Full Length Methanocaldococcus Jannaschii Uncharacterized Protein Mj1470(Mj1470) Protein, His-Tagged
Cat.No. : | RFL34302MF |
Product Overview : | Recombinant Full Length Methanocaldococcus jannaschii Uncharacterized protein MJ1470(MJ1470) Protein (Q58865) (1-624aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanocaldococcus jannaschii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-624) |
Form : | Lyophilized powder |
AA Sequence : | MFRKIVSKRGYIFTYEAIVIAFIFLSVFYIGYMVYSHNMLTALEEKKDTEKFHKALLLKD YFLRNNKFPGKFYNKTYLDNFTNELDIKEKTFDLFNNFSEYKGLIRFIIYPNIYDEELDN ISDEICANDGLQAITYNFSSNTFKIYSNVNTTFNNANLSISGMDLIYFKENVYIPKITGM KYGDSINLYGCNGDHIYFKVNSEIISASARVVTNNGNPFITWQNWRYATPILIINNLNQN LNDYDVKIVFDSQSYINSGEMRTDCGDVRFVDEDGNPLSYWIEPNTIDTPHTVAWVKVNL APNEHKLIYMLYGNPTATTTANGDNTFPLFFDDFSKGNLDNTKWTYNFNNPLFVNDTYPN GINFTYLSLDYTYYNNHNYIIYDINNTHISSISTYYPNTSVRFHANFHKKYEEWGGFYIN INGNDYNREVITNYHWGGEWLRAESSVLNQDYDSYIILQDPDLYDNWHTYEIQRDGGSSV NFIIDDAIYKTIYSNIYTGDLPISFYARKYDYSTKYGYYPVPQDEQNGNISIDWVFVRKY VEPEPTVTLLSSDVIFTVNGYIYKKPLKSVFDNIDITPNLNVGINEIRILSSPLPVEFLI KTNENTDFYYLTLSPNNVTIVVKP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MJ1470 |
Synonyms | MJ1470; Uncharacterized protein MJ1470 |
UniProt ID | Q58865 |
◆ Recombinant Proteins | ||
MITFB-9353Z | Recombinant Zebrafish MITFB | +Inquiry |
CD83-2065H | Active Recombinant Human CD83, HIgG1 Fc-tagged, mutant | +Inquiry |
SLC18A1-371H | Recombinant Human SLC18A1 | +Inquiry |
GLB1-13292H | Recombinant Human GLB1, His-tagged | +Inquiry |
ENKUR-1733HF | Recombinant Full Length Human ENKUR Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
SUMO Protease-02 | Native purified SUMO Protease, His-tagged | +Inquiry |
CFI-105H | Active Native Human Factor I | +Inquiry |
Collagen-57H | Native Human Collagen Type II | +Inquiry |
LDH5-8342H | Native Human LDH5 | +Inquiry |
PLE-172P | Active Native Porcine Esterase | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFV2-3891HCL | Recombinant Human NDUFV2 293 Cell Lysate | +Inquiry |
TANK-1256HCL | Recombinant Human TANK 293 Cell Lysate | +Inquiry |
ETHE1-6529HCL | Recombinant Human ETHE1 293 Cell Lysate | +Inquiry |
CYP2W1-7107HCL | Recombinant Human CYP2W1 293 Cell Lysate | +Inquiry |
ARHGDIB-8735HCL | Recombinant Human ARHGDIB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MJ1470 Products
Required fields are marked with *
My Review for All MJ1470 Products
Required fields are marked with *
0
Inquiry Basket