Recombinant Full Length Methanocaldococcus Jannaschii Uncharacterized Protein Mj1354(Mj1354) Protein, His-Tagged
Cat.No. : | RFL3411MF |
Product Overview : | Recombinant Full Length Methanocaldococcus jannaschii Uncharacterized protein MJ1354(MJ1354) Protein (Q58749) (1-145aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanocaldococcus jannaschii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-145) |
Form : | Lyophilized powder |
AA Sequence : | MDVGIILGILSAMGFLVFLGIGGHILIGYEIIRKISKAYEKGEDVKELENKIINKSHLTN TLEKITTFTLTSIFLFEMEKYRYVIDVGYSILFLVTLTLYLVPNLSLLVWVTFFGATVFM IMLWILRFRAIKEFNKAFIEELTTQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MJ1354 |
Synonyms | MJ1354; Uncharacterized protein MJ1354 |
UniProt ID | Q58749 |
◆ Recombinant Proteins | ||
PLP2-3876H | Recombinant Human PLP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL14105VF | Recombinant Full Length Vibrio Vulnificus Na(+)-Translocating Nadh-Quinone Reductase Subunit E(Nqre) Protein, His-Tagged | +Inquiry |
ABT1-228M | Recombinant Mouse ABT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
C8orf31-835H | Recombinant Human C8orf31 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KIR2DL4-147H | Recombinant Human KIR2DL4 | +Inquiry |
◆ Native Proteins | ||
GPT-65H | Active Native Human Glutamate Pyruvate Transaminase (GPT) | +Inquiry |
TFRC-69H | Native Human Apotransferrin | +Inquiry |
Troponin T-12H | Native Human cardiac Troponin T protein | +Inquiry |
IgG-016M | Native Mouse Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
NEFL-181B | Native bovine NEFL | +Inquiry |
◆ Cell & Tissue Lysates | ||
C9orf37-7931HCL | Recombinant Human C9orf37 293 Cell Lysate | +Inquiry |
TSPAN15-711HCL | Recombinant Human TSPAN15 293 Cell Lysate | +Inquiry |
CTGF-7205HCL | Recombinant Human CTGF 293 Cell Lysate | +Inquiry |
GZMM-5666HCL | Recombinant Human GZMM 293 Cell Lysate | +Inquiry |
SMCO3-79HCL | Recombinant Human SMCO3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MJ1354 Products
Required fields are marked with *
My Review for All MJ1354 Products
Required fields are marked with *
0
Inquiry Basket