Recombinant Full Length Methanocaldococcus Jannaschii Uncharacterized Protein Mj1147(Mj1147) Protein, His-Tagged
Cat.No. : | RFL25565MF |
Product Overview : | Recombinant Full Length Methanocaldococcus jannaschii Uncharacterized protein MJ1147(MJ1147) Protein (Q58547) (1-462aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanocaldococcus jannaschii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-462) |
Form : | Lyophilized powder |
AA Sequence : | MFILIIKCGIMEKEVISSREFIDRFVECLEKGEDFKLKDCVVEGNVDILNIYEMIKDKEL KGGYIEKKDDEIVVNINIKVDIYNVEFNGDFRFFVNMEYQIVISVFNGNAYFRVITFKGS VYFIRTIFNGDVDFIDTIFEENAYFSVTAFKGNIINFSGTIFNKESHFKSTTFEGNTYFS VTTFNIAEFYNSTFKSHVYFDDISFNLLSFTDCRFRDDVSFKKIDKENFKGLAIFLKTQF LNKHTTIENFQLSKTSFLKTDVREVLLCDVKKEEILSHKILRIKEDSGNKDKDLENKLKE LLGLSYKYIIDQFNYKSVLAEYRNLRISIENNRTYIEASNLYKMEMELIKEFSNGRFEKF IIGAYGAISDYGESMEKTGKWILGSMILFTILASILRFKGMEWDIFKIIEFWWISFWEVI RLFLQIGTEDKSLWILEPIIRVTSLILLGNLYIAVRRKLSRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MJ1147 |
Synonyms | MJ1147; Uncharacterized protein MJ1147 |
UniProt ID | Q58547 |
◆ Native Proteins | ||
Protease-20S | Active Native Streptomyces griseus Protease | +Inquiry |
calc1-8308S | Native Salmon calc1 | +Inquiry |
MAP-30 | Native Mytilus edulis MAP Protein | +Inquiry |
Lectin-1749G | Active Native Galanthus Nivalis Lectin Protein | +Inquiry |
MMP9-30035TH | Native Human MMP9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALNTL2-6032HCL | Recombinant Human GALNTL2 293 Cell Lysate | +Inquiry |
ZNF232-112HCL | Recombinant Human ZNF232 293 Cell Lysate | +Inquiry |
LYPD1-4592HCL | Recombinant Human LYPD1 293 Cell Lysate | +Inquiry |
Kidney-072MCL | Adult Mouse Kidney Whole Cell Lysate | +Inquiry |
ZNF350-2017HCL | Recombinant Human ZNF350 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MJ1147 Products
Required fields are marked with *
My Review for All MJ1147 Products
Required fields are marked with *
0
Inquiry Basket