Recombinant Full Length Methanocaldococcus Jannaschii Uncharacterized Protein Mj0904(Mj0904) Protein, His-Tagged
Cat.No. : | RFL949MF |
Product Overview : | Recombinant Full Length Methanocaldococcus jannaschii Uncharacterized protein MJ0904(MJ0904) Protein (Q58314) (1-195aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanocaldococcus jannaschii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-195) |
Form : | Lyophilized powder |
AA Sequence : | MNIENLAYNSSSDVLKAKIKNDKFPVNLTVQYWVDVSRGSNIYYKSSIFQTEIYPKSEKE LIVPLTLGDLESGIYNITLYVRVNNFALFNYQKVPVILKKSISIEINGSKGVMQQKSNKE SDEIINETSETHKNMTIDIKNLSNNKDNKSNIEESTAKNVKSNIETKKSADNNSILGKIS GFFGSIVSTIFSLFG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MJ0904 |
Synonyms | MJ0904; Uncharacterized protein MJ0904 |
UniProt ID | Q58314 |
◆ Native Proteins | ||
TFRC-16H | Native Human Apotransferrin Protein | +Inquiry |
C4B-10H | Native Human C4B Protein | +Inquiry |
PGC-132H | Native Human Pepsinogen II | +Inquiry |
PRL-8245H | Native Human Prolactin | +Inquiry |
MUC19-185B | Native Bovine Mucin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCOC-2024HCL | Recombinant Human SCOC 293 Cell Lysate | +Inquiry |
MMP19-4277HCL | Recombinant Human MMP19 293 Cell Lysate | +Inquiry |
ANP32E-8840HCL | Recombinant Human ANP32E 293 Cell Lysate | +Inquiry |
CCL7-170HCL | Recombinant Human CCL7 lysate | +Inquiry |
SEC13-2000HCL | Recombinant Human SEC13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MJ0904 Products
Required fields are marked with *
My Review for All MJ0904 Products
Required fields are marked with *
0
Inquiry Basket